BLASTX nr result
ID: Panax21_contig00009755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00009755 (681 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG52459.1|AC010852_16 hypothetical protein; 65170-71022 [Ara... 67 4e-09 emb|CBI17513.3| unnamed protein product [Vitis vinifera] 65 1e-08 ref|XP_002441880.1| hypothetical protein SORBIDRAFT_08g004180 [S... 65 1e-08 ref|XP_002266705.1| PREDICTED: nucleolar protein 6-like [Vitis v... 65 1e-08 emb|CAN72980.1| hypothetical protein VITISV_009031 [Vitis vinifera] 65 1e-08 >gb|AAG52459.1|AC010852_16 hypothetical protein; 65170-71022 [Arabidopsis thaliana] Length = 1026 Score = 66.6 bits (161), Expect = 4e-09 Identities = 27/42 (64%), Positives = 34/42 (80%) Frame = -2 Query: 128 PK*QLQDEATLALSCLDKCRDGGFVEVFMTSVDFPAKFDHCI 3 P QLQDEA+L L C++K RDGGF E+FMT +D+P K+DHCI Sbjct: 327 PGAQLQDEASLTLKCMEKLRDGGFEEIFMTKIDYPVKYDHCI 368 >emb|CBI17513.3| unnamed protein product [Vitis vinifera] Length = 1066 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -2 Query: 119 QLQDEATLALSCLDKCRDGGFVEVFMTSVDFPAKFDHCI 3 +LQDEA L LSC+ KC+DGGF E+FMT +D+PAK+D+C+ Sbjct: 358 ELQDEAVLTLSCIGKCKDGGFEELFMTKIDYPAKYDYCM 396 >ref|XP_002441880.1| hypothetical protein SORBIDRAFT_08g004180 [Sorghum bicolor] gi|241942573|gb|EES15718.1| hypothetical protein SORBIDRAFT_08g004180 [Sorghum bicolor] Length = 1008 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -2 Query: 119 QLQDEATLALSCLDKCRDGGFVEVFMTSVDFPAKFDHCI 3 +LQDEA ALSCLDKCRDGG E+FMT VDF AKFD C+ Sbjct: 311 ELQDEAACALSCLDKCRDGGLEELFMTKVDFCAKFDSCL 349 >ref|XP_002266705.1| PREDICTED: nucleolar protein 6-like [Vitis vinifera] Length = 1057 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -2 Query: 119 QLQDEATLALSCLDKCRDGGFVEVFMTSVDFPAKFDHCI 3 +LQDEA L LSC+ KC+DGGF E+FMT +D+PAK+D+C+ Sbjct: 355 ELQDEAVLTLSCIGKCKDGGFEELFMTKIDYPAKYDYCM 393 >emb|CAN72980.1| hypothetical protein VITISV_009031 [Vitis vinifera] Length = 1040 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = -2 Query: 119 QLQDEATLALSCLDKCRDGGFVEVFMTSVDFPAKFDHCI 3 +LQDEA L LSC+ KC+DGGF E+FMT +D+PAK+D+C+ Sbjct: 382 ELQDEAVLTLSCIGKCKDGGFEELFMTKIDYPAKYDYCM 420