BLASTX nr result
ID: Panax21_contig00008797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00008797 (815 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB72799.1| root border cell-specific protein-like protein [S... 58 2e-06 >gb|ABB72799.1| root border cell-specific protein-like protein [Solanum tuberosum] Length = 321 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/62 (53%), Positives = 36/62 (58%), Gaps = 22/62 (35%) Frame = +1 Query: 676 EFDKEEFRAAKVDPLYQFSKP----------------------VAVDFADILDLDSLGFN 789 EF KEEF+ AKVDP+YQFSKP V VDFA ILD+DSLGFN Sbjct: 223 EFSKEEFKTAKVDPIYQFSKPITSHMNKDHTEDTKLIVQHSKSVPVDFAYILDVDSLGFN 282 Query: 790 VK 795 VK Sbjct: 283 VK 284