BLASTX nr result
ID: Panax21_contig00008501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00008501 (849 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330462.1| p-type ATPase transporter [Populus trichocar... 64 6e-08 ref|XP_002325729.1| p-type ATPase transporter [Populus trichocar... 63 1e-07 ref|XP_004156486.1| PREDICTED: probable cation-transporting ATPa... 62 2e-07 ref|XP_004139204.1| PREDICTED: LOW QUALITY PROTEIN: probable cat... 62 2e-07 ref|XP_002513245.1| cation-transporting atpase 13a1, putative [R... 60 5e-07 >ref|XP_002330462.1| p-type ATPase transporter [Populus trichocarpa] gi|222871874|gb|EEF09005.1| p-type ATPase transporter [Populus trichocarpa] Length = 1185 Score = 63.5 bits (153), Expect = 6e-08 Identities = 32/42 (76%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +2 Query: 635 FKSKVDICCFDKTGTLTSDDMEF-SEVGLIESLELETKMTKV 757 F KVDICCFDKTGTLTSDDMEF VGL ES +LE+ MTKV Sbjct: 478 FAGKVDICCFDKTGTLTSDDMEFRGVVGLTESADLESDMTKV 519 >ref|XP_002325729.1| p-type ATPase transporter [Populus trichocarpa] gi|222862604|gb|EEF00111.1| p-type ATPase transporter [Populus trichocarpa] Length = 1188 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/42 (76%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +2 Query: 635 FKSKVDICCFDKTGTLTSDDMEF-SEVGLIESLELETKMTKV 757 F KVDICCFDKTGTLTSDDMEF VG ES +LET MTKV Sbjct: 482 FAGKVDICCFDKTGTLTSDDMEFCGVVGQTESTDLETDMTKV 523 >ref|XP_004156486.1| PREDICTED: probable cation-transporting ATPase-like [Cucumis sativus] Length = 674 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/43 (74%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +2 Query: 635 FKSKVDICCFDKTGTLTSDDMEF-SEVGLIESLELETKMTKVS 760 F KVDICCFDKTGTLTSDDMEF VGL + ELET MT VS Sbjct: 282 FAGKVDICCFDKTGTLTSDDMEFRGVVGLSDKEELETDMTSVS 324 >ref|XP_004139204.1| PREDICTED: LOW QUALITY PROTEIN: probable cation-transporting ATPase-like [Cucumis sativus] Length = 1192 Score = 62.0 bits (149), Expect = 2e-07 Identities = 32/43 (74%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = +2 Query: 635 FKSKVDICCFDKTGTLTSDDMEF-SEVGLIESLELETKMTKVS 760 F KVDICCFDKTGTLTSDDMEF VGL + ELET MT VS Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFRGVVGLSDKEELETDMTSVS 522 >ref|XP_002513245.1| cation-transporting atpase 13a1, putative [Ricinus communis] gi|223547619|gb|EEF49113.1| cation-transporting atpase 13a1, putative [Ricinus communis] Length = 1193 Score = 60.5 bits (145), Expect = 5e-07 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +2 Query: 635 FKSKVDICCFDKTGTLTSDDMEF-SEVGLIESLELETKMTKV 757 F KVDICCFDKTGTLTSDDMEF VGL + ++LE+ M+KV Sbjct: 480 FAGKVDICCFDKTGTLTSDDMEFCGVVGLTDGMDLESDMSKV 521