BLASTX nr result
ID: Panax21_contig00007407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00007407 (700 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593978.1| Serine/threonine protein kinase [Medicago tr... 105 1e-20 ref|XP_003593977.1| Serine/threonine protein kinase [Medicago tr... 105 1e-20 ref|XP_003593976.1| Protein kinase-like protein [Medicago trunca... 105 1e-20 gb|ACY92427.1| putative resistance protein LRGA-3 [Lens culinari... 104 1e-20 ref|XP_002516880.1| receptor serine-threonine protein kinase, pu... 98 1e-18 >ref|XP_003593978.1| Serine/threonine protein kinase [Medicago truncatula] gi|355483026|gb|AES64229.1| Serine/threonine protein kinase [Medicago truncatula] Length = 371 Score = 105 bits (261), Expect = 1e-20 Identities = 49/62 (79%), Positives = 56/62 (90%) Frame = -1 Query: 700 LDELERTDSQRDSPGSAGRARETPRNRDLDRERAVAAAKIWGENLREKKRGSAMGSFDAT 521 +D+LER DSQRDSP + GRARETPRNRDLDRERAVA A++WGEN REKKRG+A+GSFD T Sbjct: 310 VDDLERHDSQRDSPVNTGRARETPRNRDLDRERAVAEARVWGENWREKKRGNAVGSFDGT 369 Query: 520 NE 515 NE Sbjct: 370 NE 371 >ref|XP_003593977.1| Serine/threonine protein kinase [Medicago truncatula] gi|355483025|gb|AES64228.1| Serine/threonine protein kinase [Medicago truncatula] Length = 419 Score = 105 bits (261), Expect = 1e-20 Identities = 49/62 (79%), Positives = 56/62 (90%) Frame = -1 Query: 700 LDELERTDSQRDSPGSAGRARETPRNRDLDRERAVAAAKIWGENLREKKRGSAMGSFDAT 521 +D+LER DSQRDSP + GRARETPRNRDLDRERAVA A++WGEN REKKRG+A+GSFD T Sbjct: 358 VDDLERHDSQRDSPVNTGRARETPRNRDLDRERAVAEARVWGENWREKKRGNAVGSFDGT 417 Query: 520 NE 515 NE Sbjct: 418 NE 419 >ref|XP_003593976.1| Protein kinase-like protein [Medicago truncatula] gi|355483024|gb|AES64227.1| Protein kinase-like protein [Medicago truncatula] Length = 507 Score = 105 bits (261), Expect = 1e-20 Identities = 49/62 (79%), Positives = 56/62 (90%) Frame = -1 Query: 700 LDELERTDSQRDSPGSAGRARETPRNRDLDRERAVAAAKIWGENLREKKRGSAMGSFDAT 521 +D+LER DSQRDSP + GRARETPRNRDLDRERAVA A++WGEN REKKRG+A+GSFD T Sbjct: 446 VDDLERHDSQRDSPVNTGRARETPRNRDLDRERAVAEARVWGENWREKKRGNAVGSFDGT 505 Query: 520 NE 515 NE Sbjct: 506 NE 507 >gb|ACY92427.1| putative resistance protein LRGA-3 [Lens culinaris subsp. culinaris] Length = 71 Score = 104 bits (260), Expect = 1e-20 Identities = 49/62 (79%), Positives = 55/62 (88%) Frame = -1 Query: 700 LDELERTDSQRDSPGSAGRARETPRNRDLDRERAVAAAKIWGENLREKKRGSAMGSFDAT 521 +D+LER DSQRDSP + GRARETPRNRDLDRERAVA A++WGEN REKKR +AMGSFD T Sbjct: 10 MDDLERHDSQRDSPVNTGRARETPRNRDLDRERAVAEARVWGENWREKKRANAMGSFDGT 69 Query: 520 NE 515 NE Sbjct: 70 NE 71 >ref|XP_002516880.1| receptor serine-threonine protein kinase, putative [Ricinus communis] gi|223543968|gb|EEF45494.1| receptor serine-threonine protein kinase, putative [Ricinus communis] Length = 516 Score = 98.2 bits (243), Expect = 1e-18 Identities = 47/62 (75%), Positives = 51/62 (82%) Frame = -1 Query: 700 LDELERTDSQRDSPGSAGRARETPRNRDLDRERAVAAAKIWGENLREKKRGSAMGSFDAT 521 LD+ ER DSQR SP + R RETPRNRDLDRERAVA AK+WGEN REKKR +AMGSFD T Sbjct: 455 LDDSERQDSQRGSPVNTSRVRETPRNRDLDRERAVAEAKVWGENWREKKRANAMGSFDGT 514 Query: 520 NE 515 NE Sbjct: 515 NE 516