BLASTX nr result
ID: Panax21_contig00007392
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00007392 (530 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACN78662.1| endo-beta-mannanase [Actinidia arguta] 76 3e-12 ref|XP_002264115.1| PREDICTED: mannan endo-1,4-beta-mannosidase ... 75 6e-12 ref|XP_002521547.1| serine-threonine protein kinase, plant-type,... 74 2e-11 gb|ABV32548.1| endo-1,4-beta-mannosidase protein 2 [Prunus persica] 74 2e-11 gb|ADN34185.1| endo-beta-mannanase [Cucumis melo subsp. melo] 73 2e-11 >gb|ACN78662.1| endo-beta-mannanase [Actinidia arguta] Length = 433 Score = 76.3 bits (186), Expect = 3e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = -3 Query: 123 AIQELDFVVAEARRYGIKLMLSLVNNYESFGGKKQYVDWAR 1 A + LDFVVAEARRYGIKL+LSLVNNYESFGGKKQYV+WAR Sbjct: 106 AFKGLDFVVAEARRYGIKLVLSLVNNYESFGGKKQYVNWAR 146 >ref|XP_002264115.1| PREDICTED: mannan endo-1,4-beta-mannosidase 7 [Vitis vinifera] gi|297735122|emb|CBI17484.3| unnamed protein product [Vitis vinifera] Length = 433 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -3 Query: 111 LDFVVAEARRYGIKLMLSLVNNYESFGGKKQYVDWAR 1 LDFVVAEARRYGIKL+LSLVNNYESFGGKKQYV+WAR Sbjct: 110 LDFVVAEARRYGIKLILSLVNNYESFGGKKQYVNWAR 146 >ref|XP_002521547.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223539225|gb|EEF40818.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 874 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -3 Query: 111 LDFVVAEARRYGIKLMLSLVNNYESFGGKKQYVDWAR 1 LDFV+AEARRYGIKL+LSLVNNYE+FGGKKQYV+WAR Sbjct: 110 LDFVIAEARRYGIKLILSLVNNYETFGGKKQYVNWAR 146 >gb|ABV32548.1| endo-1,4-beta-mannosidase protein 2 [Prunus persica] Length = 433 Score = 73.6 bits (179), Expect = 2e-11 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = -3 Query: 111 LDFVVAEARRYGIKLMLSLVNNYESFGGKKQYVDWAR 1 LDFV+AEARRYGIKL+LSLVNNYESFGG+KQYV+WAR Sbjct: 110 LDFVIAEARRYGIKLILSLVNNYESFGGRKQYVNWAR 146 >gb|ADN34185.1| endo-beta-mannanase [Cucumis melo subsp. melo] Length = 425 Score = 73.2 bits (178), Expect = 2e-11 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -3 Query: 117 QELDFVVAEARRYGIKLMLSLVNNYESFGGKKQYVDWAR 1 Q LDFVVAEAR+YGIKL+LSLVNNYES GGKKQYV+WAR Sbjct: 104 QGLDFVVAEARKYGIKLILSLVNNYESMGGKKQYVEWAR 142