BLASTX nr result
ID: Panax21_contig00007377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00007377 (459 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142815.1| PREDICTED: uncharacterized protein LOC101208... 83 3e-14 gb|AFK39013.1| unknown [Lotus japonicus] 82 4e-14 gb|AFK38585.1| unknown [Lotus japonicus] 82 4e-14 ref|NP_001237233.1| uncharacterized protein LOC100305569 [Glycin... 79 3e-13 ref|NP_001236655.1| uncharacterized protein LOC100527226 [Glycin... 79 4e-13 >ref|XP_004142815.1| PREDICTED: uncharacterized protein LOC101208398 [Cucumis sativus] gi|449504261|ref|XP_004162297.1| PREDICTED: uncharacterized protein LOC101227898 [Cucumis sativus] Length = 182 Score = 82.8 bits (203), Expect = 3e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +1 Query: 337 RRKRAGLRPPGPYAWVKYEPGKPILPNQPNQGSVKRRNEKK 459 RRKRA LRPPGPYAWV Y PG+PILPNQPN+GSVKRRNEKK Sbjct: 78 RRKRASLRPPGPYAWVPYTPGQPILPNQPNEGSVKRRNEKK 118 >gb|AFK39013.1| unknown [Lotus japonicus] Length = 175 Score = 82.0 bits (201), Expect = 4e-14 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 337 RRKRAGLRPPGPYAWVKYEPGKPILPNQPNQGSVKRRNEKK 459 RRKRA LRPPGPYAWV+Y PG+PILPN+PN+GSVKRRNEKK Sbjct: 71 RRKRASLRPPGPYAWVQYTPGEPILPNKPNEGSVKRRNEKK 111 >gb|AFK38585.1| unknown [Lotus japonicus] Length = 178 Score = 82.0 bits (201), Expect = 4e-14 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +1 Query: 337 RRKRAGLRPPGPYAWVKYEPGKPILPNQPNQGSVKRRNEKK 459 RRKRA LRPPGPYAWV+Y PG+PILPN+PN+GSVKRRNEKK Sbjct: 74 RRKRASLRPPGPYAWVQYTPGEPILPNKPNEGSVKRRNEKK 114 >ref|NP_001237233.1| uncharacterized protein LOC100305569 [Glycine max] gi|255625943|gb|ACU13316.1| unknown [Glycine max] Length = 178 Score = 79.3 bits (194), Expect = 3e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 337 RRKRAGLRPPGPYAWVKYEPGKPILPNQPNQGSVKRRNEKK 459 RRKRA LRP GPYAWV+Y PG+PILPN+PN+GSVKRRNEKK Sbjct: 74 RRKRASLRPSGPYAWVQYTPGRPILPNKPNEGSVKRRNEKK 114 >ref|NP_001236655.1| uncharacterized protein LOC100527226 [Glycine max] gi|255631824|gb|ACU16279.1| unknown [Glycine max] Length = 178 Score = 79.0 bits (193), Expect = 4e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +1 Query: 337 RRKRAGLRPPGPYAWVKYEPGKPILPNQPNQGSVKRRNEKK 459 RRKRA LRP GPYAWV+Y PG+PILPN+PN+GSVKRRNEKK Sbjct: 74 RRKRASLRPSGPYAWVQYTPGQPILPNKPNEGSVKRRNEKK 114