BLASTX nr result
ID: Panax21_contig00007360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00007360 (657 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173063.1| PREDICTED: phytochrome A-associated F-box pr... 57 3e-06 ref|XP_002523077.1| Phytochrome A-associated F-box protein, puta... 56 5e-06 >ref|XP_004173063.1| PREDICTED: phytochrome A-associated F-box protein-like [Cucumis sativus] Length = 379 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +3 Query: 9 VFGFHDDGDLVV*DYVCENGHVS*DWTDRPLYT 107 VFG+HDDG+ VV YVCENGHVS WTD PLYT Sbjct: 347 VFGYHDDGEPVVRAYVCENGHVSGAWTDLPLYT 379 >ref|XP_002523077.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] gi|223537639|gb|EEF39262.1| Phytochrome A-associated F-box protein, putative [Ricinus communis] Length = 332 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +3 Query: 9 VFGFHDDGDLVV*DYVCENGHVS*DWTDRPLYT 107 VFG+HDDG+ +V YVCENGHVS WTD PLYT Sbjct: 300 VFGYHDDGEPIVRAYVCENGHVSGAWTDVPLYT 332