BLASTX nr result
ID: Panax21_contig00007192
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00007192 (528 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAP03014.1| NEP1-interacting protein [Spinacia oleracea] 66 2e-16 pir||T08862 hypothetical protein A_TM017A05.9 - Arabidopsis thal... 67 4e-16 pir||G84555 hypothetical protein At2g17730 [imported] - Arabidop... 67 4e-16 ref|NP_001189544.1| NEP1-interacting protein 2 [Arabidopsis thal... 67 4e-16 dbj|BAC43193.1| unknown protein [Arabidopsis thaliana] 67 4e-16 >emb|CAP03014.1| NEP1-interacting protein [Spinacia oleracea] Length = 235 Score = 65.9 bits (159), Expect(2) = 2e-16 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = +2 Query: 128 GFGCLLYLIDVIVSLLSGRLVR*RIGPAMLSAVQSQVQNYKRNYK 262 G GC+LYLIDVI SLLSGRLVR RIGPAMLSAVQSQ+ + N++ Sbjct: 104 GIGCILYLIDVIASLLSGRLVRERIGPAMLSAVQSQMGAVETNFE 148 Score = 44.7 bits (104), Expect(2) = 2e-16 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = +1 Query: 58 ISGVVFSIEVFESSLVLWQSDKSGL 132 ISG VFSIEVFESS+VLW+SD+SG+ Sbjct: 81 ISGAVFSIEVFESSVVLWRSDESGI 105 >pir||T08862 hypothetical protein A_TM017A05.9 - Arabidopsis thaliana Length = 292 Score = 67.0 bits (162), Expect(2) = 4e-16 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 128 GFGCLLYLIDVIVSLLSGRLVR*RIGPAMLSAVQSQV 238 GFGC LYLIDVIVSLLSGRLVR RIGPAMLSAVQSQ+ Sbjct: 123 GFGCFLYLIDVIVSLLSGRLVRERIGPAMLSAVQSQM 159 Score = 42.4 bits (98), Expect(2) = 4e-16 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 58 ISGVVFSIEVFESSLVLWQSDKSG 129 ISG VFSIEVFESSL LW+SD+SG Sbjct: 100 ISGAVFSIEVFESSLDLWKSDESG 123 >pir||G84555 hypothetical protein At2g17730 [imported] - Arabidopsis thaliana Length = 279 Score = 67.0 bits (162), Expect(2) = 4e-16 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 128 GFGCLLYLIDVIVSLLSGRLVR*RIGPAMLSAVQSQV 238 GFGC LYLIDVIVSLLSGRLVR RIGPAMLSAVQSQ+ Sbjct: 110 GFGCFLYLIDVIVSLLSGRLVRERIGPAMLSAVQSQM 146 Score = 42.4 bits (98), Expect(2) = 4e-16 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 58 ISGVVFSIEVFESSLVLWQSDKSG 129 ISG VFSIEVFESSL LW+SD+SG Sbjct: 87 ISGAVFSIEVFESSLDLWKSDESG 110 >ref|NP_001189544.1| NEP1-interacting protein 2 [Arabidopsis thaliana] gi|330251582|gb|AEC06676.1| NEP1-interacting protein 2 [Arabidopsis thaliana] Length = 253 Score = 67.0 bits (162), Expect(2) = 4e-16 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 128 GFGCLLYLIDVIVSLLSGRLVR*RIGPAMLSAVQSQV 238 GFGC LYLIDVIVSLLSGRLVR RIGPAMLSAVQSQ+ Sbjct: 110 GFGCFLYLIDVIVSLLSGRLVRERIGPAMLSAVQSQM 146 Score = 42.4 bits (98), Expect(2) = 4e-16 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 58 ISGVVFSIEVFESSLVLWQSDKSG 129 ISG VFSIEVFESSL LW+SD+SG Sbjct: 87 ISGAVFSIEVFESSLDLWKSDESG 110 >dbj|BAC43193.1| unknown protein [Arabidopsis thaliana] Length = 241 Score = 67.0 bits (162), Expect(2) = 4e-16 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +2 Query: 128 GFGCLLYLIDVIVSLLSGRLVR*RIGPAMLSAVQSQV 238 GFGC LYLIDVIVSLLSGRLVR RIGPAMLSAVQSQ+ Sbjct: 110 GFGCFLYLIDVIVSLLSGRLVRERIGPAMLSAVQSQM 146 Score = 42.4 bits (98), Expect(2) = 4e-16 Identities = 20/24 (83%), Positives = 22/24 (91%) Frame = +1 Query: 58 ISGVVFSIEVFESSLVLWQSDKSG 129 ISG VFSIEVFESSL LW+SD+SG Sbjct: 87 ISGAVFSIEVFESSLDLWKSDESG 110