BLASTX nr result
ID: Panax21_contig00006460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00006460 (738 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547136.1| PREDICTED: serine carboxypeptidase-like 31-l... 86 8e-15 ref|XP_003543073.1| PREDICTED: serine carboxypeptidase-like 31-l... 83 7e-14 ref|XP_003543072.1| PREDICTED: serine carboxypeptidase-like 31-l... 83 7e-14 gb|AFK42926.1| unknown [Medicago truncatula] 82 9e-14 ref|XP_002521402.1| serine carboxypeptidase, putative [Ricinus c... 82 9e-14 >ref|XP_003547136.1| PREDICTED: serine carboxypeptidase-like 31-like [Glycine max] Length = 482 Score = 85.9 bits (211), Expect = 8e-15 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 518 DAFAFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAGLIQDKS 387 DA+ FLHNWFLKFPSYRTRTFYIAGESYAGKYVPELA LI D++ Sbjct: 171 DAYTFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAELIHDRN 214 >ref|XP_003543073.1| PREDICTED: serine carboxypeptidase-like 31-like isoform 2 [Glycine max] Length = 472 Score = 82.8 bits (203), Expect = 7e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -2 Query: 518 DAFAFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAGLIQDKS 387 DA+ FLHNWFLKFPSY TRTFYIAGESYAGKYVPELA LI D++ Sbjct: 167 DAYTFLHNWFLKFPSYITRTFYIAGESYAGKYVPELAELIHDRN 210 >ref|XP_003543072.1| PREDICTED: serine carboxypeptidase-like 31-like isoform 1 [Glycine max] Length = 478 Score = 82.8 bits (203), Expect = 7e-14 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = -2 Query: 518 DAFAFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAGLIQDKS 387 DA+ FLHNWFLKFPSY TRTFYIAGESYAGKYVPELA LI D++ Sbjct: 167 DAYTFLHNWFLKFPSYITRTFYIAGESYAGKYVPELAELIHDRN 210 >gb|AFK42926.1| unknown [Medicago truncatula] Length = 488 Score = 82.4 bits (202), Expect = 9e-14 Identities = 36/44 (81%), Positives = 41/44 (93%) Frame = -2 Query: 518 DAFAFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAGLIQDKS 387 DA+ FLHNWFLKFPSYR++TFYIAGESYAGKYVPELA LI D++ Sbjct: 177 DAYNFLHNWFLKFPSYRSKTFYIAGESYAGKYVPELAELIHDRN 220 >ref|XP_002521402.1| serine carboxypeptidase, putative [Ricinus communis] gi|223539301|gb|EEF40892.1| serine carboxypeptidase, putative [Ricinus communis] Length = 478 Score = 82.4 bits (202), Expect = 9e-14 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -2 Query: 518 DAFAFLHNWFLKFPSYRTRTFYIAGESYAGKYVPELAGLIQDKSS 384 DA+AFLH WFLKFPSYR R FYIAGESYAGKYVPELA LI DK++ Sbjct: 167 DAYAFLHKWFLKFPSYRMRAFYIAGESYAGKYVPELAELIHDKNT 211