BLASTX nr result
ID: Panax21_contig00006433
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00006433 (747 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285554.1| PREDICTED: mitochondrial import inner membra... 102 8e-20 emb|CAN70489.1| hypothetical protein VITISV_008665 [Vitis vinifera] 102 8e-20 ref|XP_003627207.1| Translocase of inner mitochondrial membrane ... 95 2e-17 ref|XP_003546759.1| PREDICTED: mitochondrial import inner membra... 93 7e-17 ref|XP_003543579.1| PREDICTED: mitochondrial import inner membra... 91 2e-16 >ref|XP_002285554.1| PREDICTED: mitochondrial import inner membrane translocase subunit tim23 [Vitis vinifera] gi|296082145|emb|CBI21150.3| unnamed protein product [Vitis vinifera] Length = 182 Score = 102 bits (254), Expect = 8e-20 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = +3 Query: 543 SSEKKPATRRYNHYQDLQVPIRTLYELPTSPKYLFDKEAAVQRRSWSENLQYYTGSGYLA 722 S++ TR Y+ YQDLQVPI+ LY LPTSP+YLFD+E+ QRRSWSENLQYYTGSGYL+ Sbjct: 5 STDSNRKTRVYHPYQDLQVPIQNLYNLPTSPEYLFDEESLHQRRSWSENLQYYTGSGYLS 64 Query: 723 GAVTGGLK 746 GA+ GG K Sbjct: 65 GAIIGGAK 72 >emb|CAN70489.1| hypothetical protein VITISV_008665 [Vitis vinifera] Length = 450 Score = 102 bits (254), Expect = 8e-20 Identities = 47/68 (69%), Positives = 56/68 (82%) Frame = +3 Query: 543 SSEKKPATRRYNHYQDLQVPIRTLYELPTSPKYLFDKEAAVQRRSWSENLQYYTGSGYLA 722 S++ TR Y+ YQDLQVPI+ LY LPTSP+YLFD+E+ QRRSWSENLQYYTGSGYL+ Sbjct: 5 STDSNRKTRVYHPYQDLQVPIQNLYNLPTSPEYLFDEESLHQRRSWSENLQYYTGSGYLS 64 Query: 723 GAVTGGLK 746 GA+ GG K Sbjct: 65 GAIIGGAK 72 >ref|XP_003627207.1| Translocase of inner mitochondrial membrane TIM23 [Medicago truncatula] gi|355521229|gb|AET01683.1| Translocase of inner mitochondrial membrane TIM23 [Medicago truncatula] Length = 182 Score = 94.7 bits (234), Expect = 2e-17 Identities = 41/66 (62%), Positives = 53/66 (80%) Frame = +3 Query: 540 NSSEKKPATRRYNHYQDLQVPIRTLYELPTSPKYLFDKEAAVQRRSWSENLQYYTGSGYL 719 N S++ P TR YN Y+DL+VPI+ LY+LPTSP+YLFD+EA +RRSW ENL +YTG GYL Sbjct: 4 NESDQDPQTRFYNPYKDLEVPIQNLYKLPTSPEYLFDEEAKRKRRSWGENLTFYTGCGYL 63 Query: 720 AGAVTG 737 G++ G Sbjct: 64 GGSIAG 69 >ref|XP_003546759.1| PREDICTED: mitochondrial import inner membrane translocase subunit tim23-like [Glycine max] Length = 188 Score = 92.8 bits (229), Expect = 7e-17 Identities = 43/66 (65%), Positives = 53/66 (80%) Frame = +3 Query: 540 NSSEKKPATRRYNHYQDLQVPIRTLYELPTSPKYLFDKEAAVQRRSWSENLQYYTGSGYL 719 +SS+ K TR YN Y+DL+VPIR LY+LPT+P+YLF +EA +RRSW ENL +YTG GYL Sbjct: 10 SSSDPKTPTRLYNPYKDLEVPIRNLYQLPTTPEYLFVEEARRKRRSWGENLTFYTGCGYL 69 Query: 720 AGAVTG 737 AGAV G Sbjct: 70 AGAVGG 75 >ref|XP_003543579.1| PREDICTED: mitochondrial import inner membrane translocase subunit tim23-like [Glycine max] Length = 188 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/66 (63%), Positives = 52/66 (78%) Frame = +3 Query: 540 NSSEKKPATRRYNHYQDLQVPIRTLYELPTSPKYLFDKEAAVQRRSWSENLQYYTGSGYL 719 + S+ K TR YN Y+DL+VPIR LY+LPTSP+YLF +EA +RRSW ENL +YTG GYL Sbjct: 10 SGSDPKTPTRLYNPYKDLEVPIRNLYQLPTSPEYLFVEEARRKRRSWGENLTFYTGCGYL 69 Query: 720 AGAVTG 737 +GAV G Sbjct: 70 SGAVGG 75