BLASTX nr result
ID: Panax21_contig00006270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00006270 (1148 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534543.1| DNA binding protein, putative [Ricinus commu... 57 9e-06 >ref|XP_002534543.1| DNA binding protein, putative [Ricinus communis] gi|223525076|gb|EEF27839.1| DNA binding protein, putative [Ricinus communis] Length = 405 Score = 57.0 bits (136), Expect = 9e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 95 VMFQGRVNLRNPDHKFCLMEIDDYGSNNGLP 3 + F+GRVNL+NPDHKF LME DDYG NNGLP Sbjct: 132 IPFKGRVNLKNPDHKFWLMETDDYGVNNGLP 162