BLASTX nr result
ID: Panax21_contig00006217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00006217 (999 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28290.3| unnamed protein product [Vitis vinifera] 58 4e-06 ref|XP_002273670.1| PREDICTED: uncharacterized protein RP120 [Vi... 58 4e-06 >emb|CBI28290.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 57.8 bits (138), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 194 DQVSESWSYPPLNDTAKAANRVHEAIAERGWR 99 + +SESWSYPPLNDTA+AA +V EA+AERGWR Sbjct: 451 EDISESWSYPPLNDTAEAAIKVREALAERGWR 482 >ref|XP_002273670.1| PREDICTED: uncharacterized protein RP120 [Vitis vinifera] Length = 420 Score = 57.8 bits (138), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 194 DQVSESWSYPPLNDTAKAANRVHEAIAERGWR 99 + +SESWSYPPLNDTA+AA +V EA+AERGWR Sbjct: 386 EDISESWSYPPLNDTAEAAIKVREALAERGWR 417