BLASTX nr result
ID: Panax21_contig00006089
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00006089 (530 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAA02696.1| 21D7 antigen [Daucus carota] 97 1e-18 sp|Q06364.2|PSMD3_DAUCA RecName: Full=Probable 26S proteasome no... 97 1e-18 sp|P93768.1|PSMD3_TOBAC RecName: Full=Probable 26S proteasome no... 96 4e-18 ref|XP_004162914.1| PREDICTED: probable 26S proteasome non-ATPas... 91 1e-16 ref|XP_004144854.1| PREDICTED: probable 26S proteasome non-ATPas... 91 1e-16 >dbj|BAA02696.1| 21D7 antigen [Daucus carota] Length = 488 Score = 97.1 bits (240), Expect = 1e-18 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = -3 Query: 528 IASLIEAGAYAREVRRILRAVRLTIALRKKLKASVISHFLSFVLLPGSELHSRLSSYLPK 349 IASLIE+GAYAREVRRILRAVRLTIALRKKL ASV++ FL+F L+PGSE+H+RL+SYLPK Sbjct: 33 IASLIESGAYAREVRRILRAVRLTIALRKKLNASVVNAFLNFSLVPGSEVHARLASYLPK 92 >sp|Q06364.2|PSMD3_DAUCA RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 3; Short=26S proteasome subunit S3; AltName: Full=26S proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 21D7 Length = 489 Score = 97.1 bits (240), Expect = 1e-18 Identities = 49/60 (81%), Positives = 57/60 (95%) Frame = -3 Query: 528 IASLIEAGAYAREVRRILRAVRLTIALRKKLKASVISHFLSFVLLPGSELHSRLSSYLPK 349 IASLIE+GAYAREVRRILRAVRLTIALRKKL ASV++ FL+F L+PGSE+H+RL+SYLPK Sbjct: 33 IASLIESGAYAREVRRILRAVRLTIALRKKLNASVVNAFLNFSLVPGSEVHARLASYLPK 92 >sp|P93768.1|PSMD3_TOBAC RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 3; Short=26S proteasome subunit S3; AltName: Full=26S proteasome regulatory subunit RPN3; AltName: Full=Nuclear antigen 21D7 gi|1864003|dbj|BAA19252.1| 21D7 [Nicotiana tabacum] Length = 488 Score = 95.5 bits (236), Expect = 4e-18 Identities = 49/60 (81%), Positives = 56/60 (93%) Frame = -3 Query: 528 IASLIEAGAYAREVRRILRAVRLTIALRKKLKASVISHFLSFVLLPGSELHSRLSSYLPK 349 IASLIE GAYAREVRRI RAVRLT+ALRKKLKAS +S FL++VL+PGSE+HSRLSS+LPK Sbjct: 32 IASLIETGAYAREVRRISRAVRLTMALRKKLKASSLSAFLNYVLVPGSEVHSRLSSFLPK 91 >ref|XP_004162914.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Cucumis sativus] Length = 176 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/60 (71%), Positives = 55/60 (91%) Frame = -3 Query: 528 IASLIEAGAYAREVRRILRAVRLTIALRKKLKASVISHFLSFVLLPGSELHSRLSSYLPK 349 I SL+E GAYAREVRRI+RA+RLT+ALR+KLKASV+S FL+F L PGS++H+RLSS++PK Sbjct: 28 IVSLLETGAYAREVRRIVRAIRLTMALRRKLKASVLSSFLNFALPPGSDVHTRLSSFIPK 87 >ref|XP_004144854.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Cucumis sativus] Length = 481 Score = 90.5 bits (223), Expect = 1e-16 Identities = 43/60 (71%), Positives = 55/60 (91%) Frame = -3 Query: 528 IASLIEAGAYAREVRRILRAVRLTIALRKKLKASVISHFLSFVLLPGSELHSRLSSYLPK 349 I SL+E GAYAREVRRI+RA+RLT+ALR+KLKASV+S FL+F L PGS++H+RLSS++PK Sbjct: 28 IVSLLETGAYAREVRRIVRAIRLTMALRRKLKASVLSSFLNFALPPGSDVHTRLSSFIPK 87