BLASTX nr result
ID: Panax21_contig00005854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00005854 (731 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528228.1| ubiquitin-protein ligase, putative [Ricinus ... 61 3e-07 ref|NP_567501.4| armadillo/beta-catenin-like repeat-containing p... 60 4e-07 emb|CAB10425.1| hypothetical protein [Arabidopsis thaliana] gi|7... 60 4e-07 dbj|BAC43324.1| unknown protein [Arabidopsis thaliana] 60 4e-07 emb|CBI33305.3| unnamed protein product [Vitis vinifera] 59 1e-06 >ref|XP_002528228.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223532345|gb|EEF34143.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 467 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/47 (63%), Positives = 36/47 (76%) Frame = +1 Query: 1 LANKSSKSSGSTTLEESQQFLDFSQAFSDFSACSSDVSGELQRLANL 141 LA+++SK+ S + FLD SQAFSDFSACSSD+SGELQRLA L Sbjct: 88 LASRNSKTEKSAKSSSDEDFLDISQAFSDFSACSSDISGELQRLACL 134 >ref|NP_567501.4| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] gi|332658360|gb|AEE83760.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis thaliana] Length = 472 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = +1 Query: 1 LANKSSKSSGSTTLEESQQFLDFSQAFSDFSACSSDVSGELQRLANLRLASAD 159 L N +S +S +++++E + FLD SQAFSDFSACSSD+SGELQRLA L AD Sbjct: 87 LKNSNSLNSNASSMKE-EAFLDISQAFSDFSACSSDISGELQRLACLPSPEAD 138 >emb|CAB10425.1| hypothetical protein [Arabidopsis thaliana] gi|7268399|emb|CAB78691.1| hypothetical protein [Arabidopsis thaliana] Length = 459 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = +1 Query: 1 LANKSSKSSGSTTLEESQQFLDFSQAFSDFSACSSDVSGELQRLANLRLASAD 159 L N +S +S +++++E + FLD SQAFSDFSACSSD+SGELQRLA L AD Sbjct: 87 LKNSNSLNSNASSMKE-EAFLDISQAFSDFSACSSDISGELQRLACLPSPEAD 138 >dbj|BAC43324.1| unknown protein [Arabidopsis thaliana] Length = 472 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = +1 Query: 1 LANKSSKSSGSTTLEESQQFLDFSQAFSDFSACSSDVSGELQRLANLRLASAD 159 L N +S +S +++++E + FLD SQAFSDFSACSSD+SGELQRLA L AD Sbjct: 87 LKNSNSLNSNASSMKE-EAFLDISQAFSDFSACSSDISGELQRLACLPSPEAD 138 >emb|CBI33305.3| unnamed protein product [Vitis vinifera] Length = 286 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/47 (63%), Positives = 40/47 (85%) Frame = +1 Query: 1 LANKSSKSSGSTTLEESQQFLDFSQAFSDFSACSSDVSGELQRLANL 141 LA++S+KS+ S + +E ++LD S AFSDFSACSSD+SGELQRLA+L Sbjct: 78 LASRSNKSAQSPSQDE--EYLDLSHAFSDFSACSSDISGELQRLASL 122