BLASTX nr result
ID: Panax21_contig00005026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00005026 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] 86 4e-15 ref|XP_003633903.1| PREDICTED: 60S ribosomal protein L15-like is... 86 4e-15 ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-like [V... 86 4e-15 ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-like is... 86 4e-15 ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus com... 86 4e-15 >gb|ACV50439.1| ribosomal protein L15 [Jatropha curcas] Length = 204 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 501 YGKPTNHQGITQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 370 YGKPTN QG+TQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE Sbjct: 81 YGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 123 >ref|XP_003633903.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Vitis vinifera] gi|297734550|emb|CBI16601.3| unnamed protein product [Vitis vinifera] Length = 206 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 501 YGKPTNHQGITQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 370 YGKPTN QG+TQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE Sbjct: 83 YGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 125 >ref|XP_003635402.1| PREDICTED: 60S ribosomal protein L15-like [Vitis vinifera] Length = 204 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 501 YGKPTNHQGITQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 370 YGKPTN QG+TQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE Sbjct: 81 YGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 123 >ref|XP_002277836.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Vitis vinifera] Length = 204 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 501 YGKPTNHQGITQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 370 YGKPTN QG+TQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE Sbjct: 81 YGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 123 >ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis] gi|223550092|gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/44 (95%), Positives = 43/44 (97%) Frame = -3 Query: 501 YGKPTNHQGITQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 370 YGKPTN QG+TQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE Sbjct: 81 YGKPTN-QGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINE 123