BLASTX nr result
ID: Panax21_contig00004893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004893 (521 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD21696.1| Similar to gb|Z29643 protein kinase C inhibitor (... 55 5e-06 >gb|AAD21696.1| Similar to gb|Z29643 protein kinase C inhibitor (PKCI) from Zea mays and a member of HIT family PF|01230 [Arabidopsis thaliana] Length = 214 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/36 (63%), Positives = 30/36 (83%), Gaps = 3/36 (8%) Frame = -3 Query: 453 IIVLHVNSLSV---GQSVYHIHLHVLGGRQLKWPPG 355 I+++H+ L+ GQSVYH+HLHVLGGRQ+KWPPG Sbjct: 179 IVLIHMTELTSSHSGQSVYHLHLHVLGGRQMKWPPG 214