BLASTX nr result
ID: Panax21_contig00004881
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004881 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003558946.1| PREDICTED: endoribonuclease Dicer homolog 1-... 56 4e-06 ref|XP_002534335.1| RNA binding protein, putative [Ricinus commu... 56 5e-06 tpg|DAA43005.1| TPA: hypothetical protein ZEAMMB73_941906 [Zea m... 55 6e-06 >ref|XP_003558946.1| PREDICTED: endoribonuclease Dicer homolog 1-like [Brachypodium distachyon] Length = 1888 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 489 QVFQPLFDPMVTPETLPMHPVRELQER 569 +VFQPL DPMVTPETLPMHP+RELQER Sbjct: 1699 KVFQPLLDPMVTPETLPMHPIRELQER 1725 >ref|XP_002534335.1| RNA binding protein, putative [Ricinus communis] gi|223525472|gb|EEF28048.1| RNA binding protein, putative [Ricinus communis] Length = 578 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 11 EQPEFPSAERFNYLLDVMNNGSGTTEETVRHINTKYNDQE 130 E EFPSAERFNYLLDV+NNGS ++E R I+T YNDQ+ Sbjct: 517 EHAEFPSAERFNYLLDVLNNGS-SSEGKFRRISTNYNDQD 555 >tpg|DAA43005.1| TPA: hypothetical protein ZEAMMB73_941906 [Zea mays] Length = 1307 Score = 55.5 bits (132), Expect = 6e-06 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 489 QVFQPLFDPMVTPETLPMHPVRELQER 569 +VFQPL DPMVTP+TLPMHPVRELQER Sbjct: 1121 KVFQPLLDPMVTPDTLPMHPVRELQER 1147