BLASTX nr result
ID: Panax21_contig00004831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004831 (725 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517060.1| eukaryotic translation initiation factor 2c,... 97 3e-18 ref|XP_002312555.1| argonaute protein group [Populus trichocarpa... 97 4e-18 emb|CBI26319.3| unnamed protein product [Vitis vinifera] 96 8e-18 ref|XP_002279408.1| PREDICTED: protein argonaute 10-like [Vitis ... 96 8e-18 ref|XP_003556070.1| PREDICTED: protein argonaute 10-like [Glycin... 96 1e-17 >ref|XP_002517060.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] gi|223543695|gb|EEF45223.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] Length = 986 Score = 97.1 bits (240), Expect = 3e-18 Identities = 48/68 (70%), Positives = 52/68 (76%), Gaps = 7/68 (10%) Frame = -2 Query: 196 GNVRKG-------QNEINESRFPVDENSTTKSVVEYFQEMYGFTIQHTHLPCLQVGNQRK 38 GNVR+ E FPVD+NST KSVVEYFQEMYGFTIQHTHLPCLQVGNQ+K Sbjct: 380 GNVRRKYRVSGLTSQPTRELVFPVDDNSTMKSVVEYFQEMYGFTIQHTHLPCLQVGNQKK 439 Query: 37 ANYLPLEA 14 ANYLP+EA Sbjct: 440 ANYLPMEA 447 >ref|XP_002312555.1| argonaute protein group [Populus trichocarpa] gi|222852375|gb|EEE89922.1| argonaute protein group [Populus trichocarpa] Length = 996 Score = 96.7 bits (239), Expect = 4e-18 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 154 FPVDENSTTKSVVEYFQEMYGFTIQHTHLPCLQVGNQRKANYLPLEA 14 FPVD+NST KSVVEYFQEMYGFTIQHTHLPCLQVGNQ+KANYLP+EA Sbjct: 406 FPVDDNSTMKSVVEYFQEMYGFTIQHTHLPCLQVGNQKKANYLPMEA 452 >emb|CBI26319.3| unnamed protein product [Vitis vinifera] Length = 953 Score = 95.9 bits (237), Expect = 8e-18 Identities = 48/68 (70%), Positives = 51/68 (75%), Gaps = 7/68 (10%) Frame = -2 Query: 196 GNVRKG-------QNEINESRFPVDENSTTKSVVEYFQEMYGFTIQHTHLPCLQVGNQRK 38 GNVR+ E FPVD+NST KSVVEYFQEMYGFTIQH HLPCLQVGNQ+K Sbjct: 363 GNVRRKYRVSGLTSQPTRELVFPVDDNSTMKSVVEYFQEMYGFTIQHAHLPCLQVGNQKK 422 Query: 37 ANYLPLEA 14 ANYLPLEA Sbjct: 423 ANYLPLEA 430 >ref|XP_002279408.1| PREDICTED: protein argonaute 10-like [Vitis vinifera] Length = 995 Score = 95.9 bits (237), Expect = 8e-18 Identities = 48/68 (70%), Positives = 51/68 (75%), Gaps = 7/68 (10%) Frame = -2 Query: 196 GNVRKG-------QNEINESRFPVDENSTTKSVVEYFQEMYGFTIQHTHLPCLQVGNQRK 38 GNVR+ E FPVD+NST KSVVEYFQEMYGFTIQH HLPCLQVGNQ+K Sbjct: 382 GNVRRKYRVSGLTSQPTRELVFPVDDNSTMKSVVEYFQEMYGFTIQHAHLPCLQVGNQKK 441 Query: 37 ANYLPLEA 14 ANYLPLEA Sbjct: 442 ANYLPLEA 449 >ref|XP_003556070.1| PREDICTED: protein argonaute 10-like [Glycine max] Length = 974 Score = 95.5 bits (236), Expect = 1e-17 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -2 Query: 154 FPVDENSTTKSVVEYFQEMYGFTIQHTHLPCLQVGNQRKANYLPLEA 14 FPVDENST KSVVEYFQEMYGFTIQ+THLPCLQVGNQ+KANYLP+EA Sbjct: 383 FPVDENSTMKSVVEYFQEMYGFTIQYTHLPCLQVGNQKKANYLPMEA 429