BLASTX nr result
ID: Panax21_contig00004790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004790 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_198117.2| PWWP domain-containing protein [Arabidopsis tha... 65 8e-09 dbj|BAH30603.1| hypothetical protein [Arabidopsis thaliana] 65 8e-09 ref|XP_002512413.1| conserved hypothetical protein [Ricinus comm... 64 1e-08 ref|XP_003555609.1| PREDICTED: uncharacterized protein LOC100792... 64 2e-08 ref|XP_003535335.1| PREDICTED: uncharacterized protein LOC100812... 64 2e-08 >ref|NP_198117.2| PWWP domain-containing protein [Arabidopsis thaliana] gi|332006328|gb|AED93711.1| PWWP domain-containing protein [Arabidopsis thaliana] Length = 1072 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 439 DIAHQMINLLTRCNDVVANVTGLLGYVPYHPL 344 DI+HQM+NLL++CN+VVANVTGLLGYVPYHPL Sbjct: 1041 DISHQMLNLLSKCNEVVANVTGLLGYVPYHPL 1072 >dbj|BAH30603.1| hypothetical protein [Arabidopsis thaliana] Length = 1063 Score = 64.7 bits (156), Expect = 8e-09 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 439 DIAHQMINLLTRCNDVVANVTGLLGYVPYHPL 344 DI+HQM+NLL++CN+VVANVTGLLGYVPYHPL Sbjct: 1032 DISHQMLNLLSKCNEVVANVTGLLGYVPYHPL 1063 >ref|XP_002512413.1| conserved hypothetical protein [Ricinus communis] gi|223548374|gb|EEF49865.1| conserved hypothetical protein [Ricinus communis] Length = 1141 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 448 PKVDIAHQMINLLTRCNDVVANVTGLLGYVPYHPL 344 P +DI+ QM++LLTRCNDVV VTGLLGYVPYHPL Sbjct: 1107 PSIDISQQMLSLLTRCNDVVTTVTGLLGYVPYHPL 1141 >ref|XP_003555609.1| PREDICTED: uncharacterized protein LOC100792700 [Glycine max] Length = 1056 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 460 SSEQPKVDIAHQMINLLTRCNDVVANVTGLLGYVPYHPL 344 S+ P VDI+ QMI+LLTRCND+V N+T LLGYVPYHPL Sbjct: 1018 SATAPTVDISQQMISLLTRCNDIVNNLTSLLGYVPYHPL 1056 >ref|XP_003535335.1| PREDICTED: uncharacterized protein LOC100812480 [Glycine max] Length = 1045 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 460 SSEQPKVDIAHQMINLLTRCNDVVANVTGLLGYVPYHPL 344 S+ P VDI+ QMI+LLTRCND+V N+T LLGYVPYHPL Sbjct: 1007 SATAPTVDISQQMISLLTRCNDIVNNLTSLLGYVPYHPL 1045