BLASTX nr result
ID: Panax21_contig00004725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004725 (350 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAC18797.1| Contains similarity to Ste20-like kinase homolog ... 79 4e-13 ref|NP_196976.2| protein kinase family protein [Arabidopsis thal... 79 4e-13 ref|XP_002873687.1| kinase family protein [Arabidopsis lyrata su... 79 4e-13 gb|ABG66193.1| Protein kinase domain containing protein, express... 79 4e-13 emb|CAC01871.1| protein kinase-like protein [Arabidopsis thaliana] 79 4e-13 >gb|AAC18797.1| Contains similarity to Ste20-like kinase homolog from A. thaliana chromosome 4 contig gb|Z97336 [Arabidopsis thaliana] Length = 553 Score = 79.0 bits (193), Expect = 4e-13 Identities = 39/63 (61%), Positives = 45/63 (71%) Frame = +2 Query: 122 WTFASILQCSSIRRLLVCSWPCTILELAHGHAPFSKYSPMKVLLMTLQNAPPRLDCERDK 301 W ++Q + S+ T LELAHGHAPFSKY PMKVLLMTLQNAPPRLD +RDK Sbjct: 183 WMAPEVMQQLDGYDFKLWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPRLDYDRDK 242 Query: 302 RFS 310 +FS Sbjct: 243 KFS 245 >ref|NP_196976.2| protein kinase family protein [Arabidopsis thaliana] gi|27754255|gb|AAO22581.1| putative protein kinase [Arabidopsis thaliana] gi|332004683|gb|AED92066.1| protein kinase family protein [Arabidopsis thaliana] Length = 674 Score = 79.0 bits (193), Expect = 4e-13 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = +2 Query: 170 VCSWPCTILELAHGHAPFSKYSPMKVLLMTLQNAPPRLDCERDKRFS 310 V S+ T LELAHGHAPFSKY PMKVLLMTLQNAPP LD ERDKRFS Sbjct: 201 VWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFS 247 >ref|XP_002873687.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297319524|gb|EFH49946.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 653 Score = 79.0 bits (193), Expect = 4e-13 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = +2 Query: 170 VCSWPCTILELAHGHAPFSKYSPMKVLLMTLQNAPPRLDCERDKRFS 310 V S+ T LELAHGHAPFSKY PMKVLLMTLQNAPP LD ERDKRFS Sbjct: 201 VWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFS 247 >gb|ABG66193.1| Protein kinase domain containing protein, expressed [Oryza sativa Japonica Group] Length = 575 Score = 79.0 bits (193), Expect = 4e-13 Identities = 41/67 (61%), Positives = 48/67 (71%), Gaps = 5/67 (7%) Frame = +2 Query: 125 TFASILQCSSIRRLLVC-----SWPCTILELAHGHAPFSKYSPMKVLLMTLQNAPPRLDC 289 TF +L +R + +C S+ T LELAHGHAPFSKY PMKVLLMTLQNAPP LD Sbjct: 25 TFLFVLIKMDLRSVYLCRADIWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDY 84 Query: 290 ERDKRFS 310 +RD+RFS Sbjct: 85 DRDRRFS 91 >emb|CAC01871.1| protein kinase-like protein [Arabidopsis thaliana] Length = 561 Score = 79.0 bits (193), Expect = 4e-13 Identities = 39/47 (82%), Positives = 40/47 (85%) Frame = +2 Query: 170 VCSWPCTILELAHGHAPFSKYSPMKVLLMTLQNAPPRLDCERDKRFS 310 V S+ T LELAHGHAPFSKY PMKVLLMTLQNAPP LD ERDKRFS Sbjct: 201 VWSFGITALELAHGHAPFSKYPPMKVLLMTLQNAPPGLDYERDKRFS 247