BLASTX nr result
ID: Panax21_contig00004631
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004631 (496 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002278077.1| PREDICTED: uncharacterized protein LOC100264... 56 3e-06 emb|CAN82449.1| hypothetical protein VITISV_006434 [Vitis vinifera] 56 3e-06 >ref|XP_002278077.1| PREDICTED: uncharacterized protein LOC100264608 [Vitis vinifera] Length = 275 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/57 (50%), Positives = 35/57 (61%) Frame = -2 Query: 333 RSPNNELSASPPPTPRRNFTPWRSFSLSDLQNAVAATPSITALVSENRRKGGDSYGH 163 +S NN S+SPP ++ F PWRSFSLSDLQ AATP IT L N R+ + H Sbjct: 221 KSSNNAPSSSPPS--QQKFPPWRSFSLSDLQGMDAATPGITGLAGNNNRERDNELQH 275 >emb|CAN82449.1| hypothetical protein VITISV_006434 [Vitis vinifera] Length = 275 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/57 (50%), Positives = 35/57 (61%) Frame = -2 Query: 333 RSPNNELSASPPPTPRRNFTPWRSFSLSDLQNAVAATPSITALVSENRRKGGDSYGH 163 +S NN S+SPP ++ F PWRSFSLSDLQ AATP IT L N R+ + H Sbjct: 221 KSSNNAPSSSPPS--QQKFPPWRSFSLSDLQGMDAATPGITGLAGNNNRERDNELQH 275