BLASTX nr result
ID: Panax21_contig00004511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004511 (464 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14987.3| unnamed protein product [Vitis vinifera] 53 3e-06 >emb|CBI14987.3| unnamed protein product [Vitis vinifera] Length = 469 Score = 52.8 bits (125), Expect(2) = 3e-06 Identities = 26/39 (66%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = +2 Query: 350 PVISDSDHQSP-ANQTFRSHQELQRLKRIRAYLRKINKP 463 P+ SDS H P ANQTF +LQ+LKR+RAYLRKINKP Sbjct: 72 PIPSDSGHHRPTANQTFHPGLQLQKLKRVRAYLRKINKP 110 Score = 23.1 bits (48), Expect(2) = 3e-06 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 190 CVVDNIRGQN*CIQTQFHLTEETTT 264 C V + GQ C + Q L +ETTT Sbjct: 14 CCVHHTTGQAQCTRIQTILPQETTT 38