BLASTX nr result
ID: Panax21_contig00004501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004501 (1251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002304003.1| predicted protein [Populus trichocarpa] gi|2... 49 2e-06 >ref|XP_002304003.1| predicted protein [Populus trichocarpa] gi|222841435|gb|EEE78982.1| predicted protein [Populus trichocarpa] Length = 188 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = +3 Query: 837 MDGQILLGRQLTVVFAEENRKKPTDM 914 MDG++ LGR+LTVVFAEENRKKP DM Sbjct: 46 MDGRVFLGRELTVVFAEENRKKPVDM 71 Score = 30.4 bits (67), Expect(2) = 2e-06 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 1/40 (2%) Frame = +1 Query: 1012 AMPDHDLIAVTTPPLPREGSTRG-LFHLKRKGIVEKGHTH 1128 AM L V PL +EG + LFH +R G V++GH H Sbjct: 108 AMQHPGLTVVIIIPLQKEGIPQADLFHPERGGTVKRGHIH 147