BLASTX nr result
ID: Panax21_contig00004469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004469 (876 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH05075.1| ferritin [Conyza canadensis] 54 1e-11 gb|ABB29922.1| unknown [Solanum tuberosum] 51 2e-11 ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] gi|2... 52 2e-11 gb|AFO70135.1| ferritin Fer11;1 [Glycine max] 52 2e-11 ref|NP_181559.1| ferritin 4 [Arabidopsis thaliana] gi|29839414|s... 51 3e-11 >emb|CAH05075.1| ferritin [Conyza canadensis] Length = 254 Score = 53.9 bits (128), Expect(2) = 1e-11 Identities = 26/32 (81%), Positives = 27/32 (84%) Frame = +3 Query: 3 NIHGGKVKLQSIIMSLSEFDHAEKGDALYGGE 98 N GGKVKLQSI+M LSEFDHAEKGDALY E Sbjct: 145 NKRGGKVKLQSILMPLSEFDHAEKGDALYAME 176 Score = 42.0 bits (97), Expect(2) = 1e-11 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 91 VASRNNDVQLADFVESEFLTEQI 159 VA++NNDVQLADFVESEFL EQ+ Sbjct: 195 VATKNNDVQLADFVESEFLGEQV 217 >gb|ABB29922.1| unknown [Solanum tuberosum] Length = 251 Score = 51.2 bits (121), Expect(2) = 2e-11 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = +3 Query: 3 NIHGGKVKLQSIIMSLSEFDHAEKGDALYGGE 98 N GGKVKLQSI+M L+EFDH EKGDALY E Sbjct: 143 NKRGGKVKLQSILMPLTEFDHVEKGDALYAME 174 Score = 44.3 bits (103), Expect(2) = 2e-11 Identities = 21/23 (91%), Positives = 22/23 (95%) Frame = +1 Query: 91 VASRNNDVQLADFVESEFLTEQI 159 VASRNNDVQLADFVESEFL EQ+ Sbjct: 193 VASRNNDVQLADFVESEFLGEQV 215 >ref|NP_001237032.1| ferritin-3, chloroplastic [Glycine max] gi|29839387|sp|Q948P6.1|FRI3_SOYBN RecName: Full=Ferritin-3, chloroplastic; AltName: Full=SFerH-3; Flags: Precursor gi|15487307|dbj|BAB64536.1| ferritin [Glycine max] Length = 256 Score = 52.4 bits (124), Expect(2) = 2e-11 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +3 Query: 3 NIHGGKVKLQSIIMSLSEFDHAEKGDALYGGE 98 N GGKVKLQSI+M LSEFDH EKGDALY E Sbjct: 147 NKRGGKVKLQSIVMPLSEFDHEEKGDALYAME 178 Score = 42.7 bits (99), Expect(2) = 2e-11 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 91 VASRNNDVQLADFVESEFLTEQI 159 VAS+NNDVQLADF+ESEFL EQ+ Sbjct: 197 VASKNNDVQLADFIESEFLGEQV 219 >gb|AFO70135.1| ferritin Fer11;1 [Glycine max] Length = 256 Score = 52.4 bits (124), Expect(2) = 2e-11 Identities = 25/32 (78%), Positives = 26/32 (81%) Frame = +3 Query: 3 NIHGGKVKLQSIIMSLSEFDHAEKGDALYGGE 98 N GGKVKLQSI+M LSEFDH EKGDALY E Sbjct: 147 NKRGGKVKLQSIVMPLSEFDHEEKGDALYAME 178 Score = 42.7 bits (99), Expect(2) = 2e-11 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 91 VASRNNDVQLADFVESEFLTEQI 159 VAS+NNDVQLADF+ESEFL EQ+ Sbjct: 197 VASKNNDVQLADFIESEFLGEQV 219 >ref|NP_181559.1| ferritin 4 [Arabidopsis thaliana] gi|29839414|sp|Q9S756.1|FRI4_ARATH RecName: Full=Ferritin-4, chloroplastic; Flags: Precursor gi|4588004|gb|AAD25945.1|AF085279_18 hypothetical ferritin subunit [Arabidopsis thaliana] gi|4586047|gb|AAD25665.1| putative ferritin [Arabidopsis thaliana] gi|17065438|gb|AAL32873.1| putative ferritin [Arabidopsis thaliana] gi|18072930|emb|CAC85400.1| ferritin subunit 4 [Arabidopsis thaliana] gi|20148573|gb|AAM10177.1| putative ferritin [Arabidopsis thaliana] gi|330254716|gb|AEC09810.1| ferritin 4 [Arabidopsis thaliana] Length = 259 Score = 51.2 bits (121), Expect(2) = 3e-11 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = +3 Query: 3 NIHGGKVKLQSIIMSLSEFDHAEKGDALYGGE 98 N GG+VKLQSI+M LSEF+H +KGDALYG E Sbjct: 155 NKRGGRVKLQSIVMPLSEFEHVDKGDALYGME 186 Score = 43.5 bits (101), Expect(2) = 3e-11 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = +1 Query: 91 VASRNNDVQLADFVESEFLTEQI 159 VAS+NNDV LADF+ESEFLTEQ+ Sbjct: 205 VASKNNDVHLADFIESEFLTEQV 227