BLASTX nr result
ID: Panax21_contig00004355
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004355 (386 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002328231.1| predicted protein [Populus trichocarpa] gi|2... 60 1e-07 ref|XP_002313610.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 emb|CBI28290.3| unnamed protein product [Vitis vinifera] 58 7e-07 ref|XP_002523838.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 ref|XP_002273670.1| PREDICTED: uncharacterized protein RP120 [Vi... 58 7e-07 >ref|XP_002328231.1| predicted protein [Populus trichocarpa] gi|222837746|gb|EEE76111.1| predicted protein [Populus trichocarpa] Length = 424 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 384 FTGLEDVSESWSYPPLNDTAEAANRVHEAIAE 289 FTG ED+SESWSYPPLNDTAE A RVHE +AE Sbjct: 386 FTGSEDISESWSYPPLNDTAEVARRVHEVLAE 417 >ref|XP_002313610.1| predicted protein [Populus trichocarpa] gi|222850018|gb|EEE87565.1| predicted protein [Populus trichocarpa] Length = 424 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -3 Query: 384 FTGLEDVSESWSYPPLNDTAEAANRVHEAIAE 289 FTG ED+SESWSYPPLNDTAE A RVH+ +AE Sbjct: 386 FTGSEDISESWSYPPLNDTAEVARRVHDVLAE 417 >emb|CBI28290.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 384 FTGLEDVSESWSYPPLNDTAEAANRVHEAIAE 289 FTG ED+SESWSYPPLNDTAEAA +V EA+AE Sbjct: 447 FTGSEDISESWSYPPLNDTAEAAIKVREALAE 478 >ref|XP_002523838.1| conserved hypothetical protein [Ricinus communis] gi|223536926|gb|EEF38564.1| conserved hypothetical protein [Ricinus communis] Length = 419 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 384 FTGLEDVSESWSYPPLNDTAEAANRVHEAIAE 289 FTG ED+SESWSYPPLNDTAEAA RV E +AE Sbjct: 381 FTGSEDISESWSYPPLNDTAEAARRVQEFLAE 412 >ref|XP_002273670.1| PREDICTED: uncharacterized protein RP120 [Vitis vinifera] Length = 420 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 384 FTGLEDVSESWSYPPLNDTAEAANRVHEAIAE 289 FTG ED+SESWSYPPLNDTAEAA +V EA+AE Sbjct: 382 FTGSEDISESWSYPPLNDTAEAAIKVREALAE 413