BLASTX nr result
ID: Panax21_contig00004346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004346 (815 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301504.1| predicted protein [Populus trichocarpa] gi|2... 73 7e-11 ref|XP_002515302.1| DNA replication regulator dpb11, putative [R... 70 7e-10 ref|XP_002270203.2| PREDICTED: BRCT domain-containing protein At... 68 2e-09 emb|CAN62071.1| hypothetical protein VITISV_036193 [Vitis vinifera] 68 2e-09 ref|XP_003535960.1| PREDICTED: BRCT domain-containing protein At... 68 3e-09 >ref|XP_002301504.1| predicted protein [Populus trichocarpa] gi|222843230|gb|EEE80777.1| predicted protein [Populus trichocarpa] Length = 1221 Score = 73.2 bits (178), Expect = 7e-11 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = -3 Query: 267 EGEKYVLAKKMKKIKLVNHLWLEDCLKAWEILPEADYNKRAERRSKMH 124 EGEKY LA KMKK+KLVNH WLEDCL+ WE+LPE +Y+KR R + H Sbjct: 155 EGEKYELANKMKKMKLVNHRWLEDCLRNWELLPEDNYSKRIMSRKRGH 202 >ref|XP_002515302.1| DNA replication regulator dpb11, putative [Ricinus communis] gi|223545782|gb|EEF47286.1| DNA replication regulator dpb11, putative [Ricinus communis] Length = 1069 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = -3 Query: 267 EGEKYVLAKKMKKIKLVNHLWLEDCLKAWEILPEADYNKRAERRSKMHLKGK 112 EGEKY LA K+KKIKLVNH WLEDCL+ WE+LPE +Y+K M + K Sbjct: 154 EGEKYELANKLKKIKLVNHRWLEDCLRDWELLPEDNYSKSGYELEMMEAEAK 205 >ref|XP_002270203.2| PREDICTED: BRCT domain-containing protein At4g02110-like [Vitis vinifera] Length = 1314 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 267 EGEKYVLAKKMKKIKLVNHLWLEDCLKAWEILPEADY 157 EGEKY LAKK+K IKLVNH WLEDCLKAW+ILPE +Y Sbjct: 154 EGEKYELAKKLKTIKLVNHRWLEDCLKAWKILPEDNY 190 >emb|CAN62071.1| hypothetical protein VITISV_036193 [Vitis vinifera] Length = 1391 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -3 Query: 267 EGEKYVLAKKMKKIKLVNHLWLEDCLKAWEILPEADY 157 EGEKY LAKK+K IKLVNH WLEDCLKAW+ILPE +Y Sbjct: 154 EGEKYELAKKLKTIKLVNHRWLEDCLKAWKILPEDNY 190 >ref|XP_003535960.1| PREDICTED: BRCT domain-containing protein At4g02110-like [Glycine max] Length = 200 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -3 Query: 267 EGEKYVLAKKMKKIKLVNHLWLEDCLKAWEILPEADYNKRAER 139 EGEKY LAKK+ IKLVNH WLEDCLK W +LPE YNKR R Sbjct: 155 EGEKYELAKKLGTIKLVNHRWLEDCLKEWVLLPEDKYNKRLGR 197