BLASTX nr result
ID: Panax21_contig00004141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004141 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003625566.1| Pentatricopeptide repeat-containing protein ... 62 4e-08 ref|XP_003554352.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_004167767.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 59 5e-07 ref|XP_002525196.1| pentatricopeptide repeat-containing protein,... 57 2e-06 >ref|XP_003625566.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355500581|gb|AES81784.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 829 Score = 62.4 bits (150), Expect = 4e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 429 DLRTQKITPNLYVFNSLMNVNARDLSYTLQIYKHMQK 319 DL QKITPN+YVFNSLMNVNA DLSY+L +Y++MQK Sbjct: 240 DLLNQKITPNIYVFNSLMNVNAHDLSYSLNLYQNMQK 276 >ref|XP_003554352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Glycine max] Length = 811 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -2 Query: 429 DLRTQKITPNLYVFNSLMNVNARDLSYTLQIYKHMQ 322 DL QKITPN+YVFNSLMNVN+ DLSYTL +Y++MQ Sbjct: 252 DLLNQKITPNIYVFNSLMNVNSHDLSYTLNLYQNMQ 287 >ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Vitis vinifera] gi|297741486|emb|CBI32618.3| unnamed protein product [Vitis vinifera] Length = 842 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -2 Query: 429 DLRTQKITPNLYVFNSLMNVNARDLSYTLQIYKHMQ 322 +L QKITPN+YVFNSLMNVN DLSYT +YK+MQ Sbjct: 270 ELLAQKITPNIYVFNSLMNVNVHDLSYTFNVYKNMQ 305 >ref|XP_004167767.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Cucumis sativus] Length = 855 Score = 58.5 bits (140), Expect = 5e-07 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -2 Query: 429 DLRTQKITPNLYVFNSLMNVNARDLSYTLQIYKHMQ 322 DL Q +TPN++VFNSLMNVNA DL+YT Q+YK+MQ Sbjct: 286 DLVNQNVTPNIFVFNSLMNVNAHDLNYTFQLYKNMQ 321 >ref|XP_002525196.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535493|gb|EEF37162.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 786 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = -2 Query: 429 DLRTQKITPNLYVFNSLMNVNARDLSYTLQIYKHMQ 322 D+ +QK+ PN++VFNSLMNVNA DL YTL +YK MQ Sbjct: 214 DIVSQKVIPNIFVFNSLMNVNAHDLGYTLHVYKKMQ 249