BLASTX nr result
ID: Panax21_contig00004006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00004006 (398 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAV32822.1| transposase [Zea mays] 55 5e-06 >gb|AAV32822.1| transposase [Zea mays] Length = 674 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 380 FSTGGRILDSFRSSLTPRMVQEIICSQDWLR 288 FSTGGRILD FRSSLTP M++ ++C+QDWLR Sbjct: 590 FSTGGRILDDFRSSLTPFMLESLVCTQDWLR 620