BLASTX nr result
ID: Panax21_contig00003968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00003968 (2169 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601616.1| Ubiquitin carboxyl-terminal hydrolase [Medic... 60 2e-06 ref|XP_002300170.1| predicted protein [Populus trichocarpa] gi|2... 60 3e-06 >ref|XP_003601616.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] gi|355490664|gb|AES71867.1| Ubiquitin carboxyl-terminal hydrolase [Medicago truncatula] Length = 1070 Score = 60.1 bits (144), Expect = 2e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 2168 SQDARGRISKLNGHVDFRDTFDLKPYMHPRC 2076 SQDARGR+SKLNGHV+FR+T DL+PYM PRC Sbjct: 962 SQDARGRLSKLNGHVNFRETMDLRPYMDPRC 992 >ref|XP_002300170.1| predicted protein [Populus trichocarpa] gi|222847428|gb|EEE84975.1| predicted protein [Populus trichocarpa] Length = 925 Score = 59.7 bits (143), Expect = 3e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 2168 SQDARGRISKLNGHVDFRDTFDLKPYMHPRC 2076 SQDARGR+SKLNGHV+FRD DL+PYM PRC Sbjct: 816 SQDARGRLSKLNGHVNFRDVLDLRPYMDPRC 846