BLASTX nr result
ID: Panax21_contig00003928
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00003928 (657 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAX20028.1| purple acid phosphatase [Medicago truncatula] 75 1e-11 dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] 74 2e-11 dbj|BAC55155.1| purple acid phosphatase [Nicotiana tabacum] 74 2e-11 ref|XP_002263971.1| PREDICTED: purple acid phosphatase 2 isoform... 74 3e-11 ref|XP_002264050.1| PREDICTED: purple acid phosphatase 2 isoform... 74 3e-11 >gb|AAX20028.1| purple acid phosphatase [Medicago truncatula] Length = 465 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 3 DSNQTLNHYELNPTKGKDVLFVGDLSYVDNYPNHDNTR 116 DSN+TL+HYELNPTKG+ VLFVGDLSY DNYPNHDN R Sbjct: 169 DSNKTLSHYELNPTKGQTVLFVGDLSYADNYPNHDNVR 206 >dbj|BAC55157.1| purple acid phosphatase [Nicotiana tabacum] Length = 470 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 3 DSNQTLNHYELNPTKGKDVLFVGDLSYVDNYPNHDNTR 116 DSN+TL HYELNP KG+ VLFVGDLSY DNYPNHDNTR Sbjct: 175 DSNRTLTHYELNPIKGQTVLFVGDLSYADNYPNHDNTR 212 >dbj|BAC55155.1| purple acid phosphatase [Nicotiana tabacum] Length = 470 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 3 DSNQTLNHYELNPTKGKDVLFVGDLSYVDNYPNHDNTR 116 DSN+TL HYELNPTKG+ VLFVGDLSY DNYPNHDN R Sbjct: 175 DSNKTLTHYELNPTKGQAVLFVGDLSYADNYPNHDNVR 212 >ref|XP_002263971.1| PREDICTED: purple acid phosphatase 2 isoform 2 [Vitis vinifera] Length = 446 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = +3 Query: 3 DSNQTLNHYELNPTKGKDVLFVGDLSYVDNYPNHDNTR 116 DSN TL HYELNP KGK VLFVGDLSY DNYPNHDN R Sbjct: 151 DSNMTLTHYELNPAKGKTVLFVGDLSYADNYPNHDNVR 188 >ref|XP_002264050.1| PREDICTED: purple acid phosphatase 2 isoform 3 [Vitis vinifera] Length = 447 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/38 (84%), Positives = 32/38 (84%) Frame = +3 Query: 3 DSNQTLNHYELNPTKGKDVLFVGDLSYVDNYPNHDNTR 116 DSN TL HYELNP KGK VLFVGDLSY DNYPNHDN R Sbjct: 177 DSNMTLTHYELNPAKGKTVLFVGDLSYADNYPNHDNVR 214