BLASTX nr result
ID: Panax21_contig00003680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00003680 (615 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFE88173.1| g-thionin [Panax ginseng] 115 5e-24 ref|XP_002513755.1| Low-molecular-weight cysteine-rich protein L... 82 7e-14 ref|NP_001240040.1| uncharacterized protein LOC100787787 [Glycin... 77 2e-12 gb|ACU13843.1| unknown [Glycine max] 77 2e-12 gb|AFH74424.1| defensin [Malus x domestica] 75 7e-12 >gb|AFE88173.1| g-thionin [Panax ginseng] Length = 75 Score = 115 bits (289), Expect = 5e-24 Identities = 55/55 (100%), Positives = 55/55 (100%) Frame = -2 Query: 476 MGVLMRLFTTIFMVLMLLMATGLEPAEGRTCESQSHKFKGTCASGTNCANVCKTE 312 MGVLMRLFTTIFMVLMLLMATGLEPAEGRTCESQSHKFKGTCASGTNCANVCKTE Sbjct: 1 MGVLMRLFTTIFMVLMLLMATGLEPAEGRTCESQSHKFKGTCASGTNCANVCKTE 55 >ref|XP_002513755.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative [Ricinus communis] gi|223546841|gb|EEF48338.1| Low-molecular-weight cysteine-rich protein LCR69 precursor, putative [Ricinus communis] Length = 77 Score = 82.0 bits (201), Expect = 7e-14 Identities = 38/53 (71%), Positives = 46/53 (86%), Gaps = 2/53 (3%) Frame = -2 Query: 464 MRLFTTIFMVLMLLMAT--GLEPAEGRTCESQSHKFKGTCASGTNCANVCKTE 312 MRLF+T+F++L+LL+AT G + AE RTCESQSHKFKGTC S TNCAN+CKTE Sbjct: 5 MRLFSTVFLLLLLLVATEMGAKVAEARTCESQSHKFKGTCLSTTNCANICKTE 57 >ref|NP_001240040.1| uncharacterized protein LOC100787787 [Glycine max] gi|255647983|gb|ACU24448.1| unknown [Glycine max] Length = 90 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = +1 Query: 253 QCVVQKQRRRKPLHLPPGKPSVLQTLAQLVPLAHVPLNLWLCDSHVLPS 399 Q +VQKQRRRKPLHLPP KPS LQT AQL L H P N WLCDSH LPS Sbjct: 5 QILVQKQRRRKPLHLPPEKPSFLQTKAQLWSLLHKPWNPWLCDSHTLPS 53 >gb|ACU13843.1| unknown [Glycine max] Length = 90 Score = 77.4 bits (189), Expect = 2e-12 Identities = 37/49 (75%), Positives = 38/49 (77%) Frame = +1 Query: 253 QCVVQKQRRRKPLHLPPGKPSVLQTLAQLVPLAHVPLNLWLCDSHVLPS 399 Q +VQKQRRRKPLHLPP KPS LQT AQL L H P N WLCDSH LPS Sbjct: 5 QILVQKQRRRKPLHLPPEKPSFLQTKAQLWSLLHKPWNPWLCDSHTLPS 53 >gb|AFH74424.1| defensin [Malus x domestica] Length = 75 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -2 Query: 464 MRLFTTIFMVLMLLMATGLEPAEGRTCESQSHKFKGTCASGTNCANVCKTE 312 MRLF T F+ L+LL+ATG AEGRTCESQS++FKGTC S +NCA VC+TE Sbjct: 5 MRLFPTAFVFLLLLVATGTMVAEGRTCESQSNRFKGTCVSKSNCAAVCQTE 55