BLASTX nr result
ID: Panax21_contig00002304
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00002304 (788 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003517174.1| PREDICTED: auxin response factor 6-like [Gly... 68 7e-23 ref|XP_003529091.1| PREDICTED: auxin response factor 25-like [Gl... 69 2e-22 ref|XP_002519813.1| Auxin response factor, putative [Ricinus com... 69 3e-22 ref|XP_002266603.2| PREDICTED: auxin response factor 5-like [Vit... 67 4e-22 emb|CBI24055.3| unnamed protein product [Vitis vinifera] 67 4e-22 >ref|XP_003517174.1| PREDICTED: auxin response factor 6-like [Glycine max] Length = 1104 Score = 68.2 bits (165), Expect(2) = 7e-23 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 375 KEFVNCFRCIKILSPQEVQQMSLDGDFGNNALLNHAC 265 +EFVNC RCIKILSPQEVQQMSLDGDFGN L N AC Sbjct: 1060 EEFVNCVRCIKILSPQEVQQMSLDGDFGNGGLPNQAC 1096 Score = 65.5 bits (158), Expect(2) = 7e-23 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -1 Query: 530 YTKVYKRGAVGRSIDIARYSGYEELKQDLARR 435 YTKVYKRGAVGRSIDI RYSGYEELKQDLARR Sbjct: 994 YTKVYKRGAVGRSIDITRYSGYEELKQDLARR 1025 >ref|XP_003529091.1| PREDICTED: auxin response factor 25-like [Glycine max] Length = 1110 Score = 68.6 bits (166), Expect(2) = 2e-22 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -3 Query: 375 KEFVNCFRCIKILSPQEVQQMSLDGDFGNNALLNHAC 265 +EFVNC RCIKILSPQEVQQMSLDGDFGN L N AC Sbjct: 1066 EEFVNCVRCIKILSPQEVQQMSLDGDFGNGGLQNQAC 1102 Score = 63.9 bits (154), Expect(2) = 2e-22 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 530 YTKVYKRGAVGRSIDIARYSGYEELKQDLARR 435 YTKVYKRGAVGRSIDI RYSGYEELK+DLARR Sbjct: 1000 YTKVYKRGAVGRSIDITRYSGYEELKKDLARR 1031 >ref|XP_002519813.1| Auxin response factor, putative [Ricinus communis] gi|223541052|gb|EEF42609.1| Auxin response factor, putative [Ricinus communis] Length = 1109 Score = 68.6 bits (166), Expect(2) = 3e-22 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -3 Query: 375 KEFVNCFRCIKILSPQEVQQMSLDGDFGNNALLNHAC 265 +EFVNC RCIKILSPQEVQQMSLDGDFGN+ L N AC Sbjct: 1065 EEFVNCVRCIKILSPQEVQQMSLDGDFGNSGLPNQAC 1101 Score = 62.8 bits (151), Expect(2) = 3e-22 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 530 YTKVYKRGAVGRSIDIARYSGYEELKQDLARR 435 YTKVYKRGAVGRSIDI RYSGY ELKQDLARR Sbjct: 999 YTKVYKRGAVGRSIDITRYSGYVELKQDLARR 1030 >ref|XP_002266603.2| PREDICTED: auxin response factor 5-like [Vitis vinifera] Length = 1117 Score = 66.6 bits (161), Expect(2) = 4e-22 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 375 KEFVNCFRCIKILSPQEVQQMSLDGDFGNNALLNHAC 265 +EFVNC RCIKILSPQEVQQMSLDGD GN+ L N AC Sbjct: 1073 EEFVNCVRCIKILSPQEVQQMSLDGDIGNSVLQNQAC 1109 Score = 64.3 bits (155), Expect(2) = 4e-22 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 530 YTKVYKRGAVGRSIDIARYSGYEELKQDLARR 435 YTKVYKRGAVGRSIDI RYSGY+ELKQDLARR Sbjct: 1007 YTKVYKRGAVGRSIDITRYSGYDELKQDLARR 1038 >emb|CBI24055.3| unnamed protein product [Vitis vinifera] Length = 1034 Score = 66.6 bits (161), Expect(2) = 4e-22 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 375 KEFVNCFRCIKILSPQEVQQMSLDGDFGNNALLNHAC 265 +EFVNC RCIKILSPQEVQQMSLDGD GN+ L N AC Sbjct: 990 EEFVNCVRCIKILSPQEVQQMSLDGDIGNSVLQNQAC 1026 Score = 64.3 bits (155), Expect(2) = 4e-22 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 530 YTKVYKRGAVGRSIDIARYSGYEELKQDLARR 435 YTKVYKRGAVGRSIDI RYSGY+ELKQDLARR Sbjct: 924 YTKVYKRGAVGRSIDITRYSGYDELKQDLARR 955