BLASTX nr result
ID: Panax21_contig00002279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00002279 (895 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220... 43 2e-06 >ref|XP_004151750.1| PREDICTED: uncharacterized protein LOC101220238, partial [Cucumis sativus] Length = 169 Score = 42.7 bits (99), Expect(3) = 2e-06 Identities = 17/37 (45%), Positives = 24/37 (64%) Frame = +1 Query: 4 PIWVKFHNIPMSYWSPAGLSYLASGVGVPLFVDKITE 114 P+W+K IP+ W+ AGL +AS +G PL VD T+ Sbjct: 52 PVWIKLGRIPLELWTDAGLVVVASAIGKPLSVDLATK 88 Score = 28.1 bits (61), Expect(3) = 2e-06 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +2 Query: 326 PQICSHCKTFGHSLLRCPK 382 P+ C+ C +FGHS CPK Sbjct: 131 PRKCNLCHSFGHSQSTCPK 149 Score = 26.9 bits (58), Expect(3) = 2e-06 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = +3 Query: 126 MNFARICVEITPSSALPSSLEVVVLDEE 209 +++ARICVE+ S +P + V + EE Sbjct: 93 LSYARICVELNVDSTMPIEITVNLRGEE 120