BLASTX nr result
ID: Panax21_contig00002140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00002140 (1602 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002283760.2| PREDICTED: BEACH domain-containing protein l... 74 1e-10 emb|CBI19283.3| unnamed protein product [Vitis vinifera] 74 1e-10 ref|XP_002527372.1| conserved hypothetical protein [Ricinus comm... 72 3e-10 ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts... 72 5e-10 ref|XP_003602889.1| Neurobeachin [Medicago truncatula] gi|355491... 71 9e-10 >ref|XP_002283760.2| PREDICTED: BEACH domain-containing protein lvsC-like, partial [Vitis vinifera] Length = 2754 Score = 73.9 bits (180), Expect = 1e-10 Identities = 41/72 (56%), Positives = 51/72 (70%), Gaps = 2/72 (2%) Frame = +1 Query: 433 RQSIALSDIKALITFFETSQDMVCIEDVLHMVICAISQKQLLAIYLKLARTV--CSVNTI 606 RQ+IA SDIKAL+ FFETSQDM CIEDVLHMVI A+SQK LLA +L+ + C + Sbjct: 1056 RQNIAASDIKALVAFFETSQDMACIEDVLHMVIRAVSQKSLLASFLEQVNLIGGCHIFVN 1115 Query: 607 LL*LPQLKPIEL 642 LL + +P+ L Sbjct: 1116 LL-QREFEPVRL 1126 >emb|CBI19283.3| unnamed protein product [Vitis vinifera] Length = 3077 Score = 73.9 bits (180), Expect = 1e-10 Identities = 41/72 (56%), Positives = 51/72 (70%), Gaps = 2/72 (2%) Frame = +1 Query: 433 RQSIALSDIKALITFFETSQDMVCIEDVLHMVICAISQKQLLAIYLKLARTV--CSVNTI 606 RQ+IA SDIKAL+ FFETSQDM CIEDVLHMVI A+SQK LLA +L+ + C + Sbjct: 1582 RQNIAASDIKALVAFFETSQDMACIEDVLHMVIRAVSQKSLLASFLEQVNLIGGCHIFVN 1641 Query: 607 LL*LPQLKPIEL 642 LL + +P+ L Sbjct: 1642 LL-QREFEPVRL 1652 >ref|XP_002527372.1| conserved hypothetical protein [Ricinus communis] gi|223533291|gb|EEF35044.1| conserved hypothetical protein [Ricinus communis] Length = 3206 Score = 72.4 bits (176), Expect = 3e-10 Identities = 38/50 (76%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +1 Query: 427 MC-RQSIALSDIKALITFFETSQDMVCIEDVLHMVICAISQKQLLAIYLK 573 MC RQSIA +DIKALI FFETSQDM CIEDVLHMVI A+SQK LL +L+ Sbjct: 1508 MCLRQSIAAADIKALIAFFETSQDMTCIEDVLHMVIRALSQKPLLIAFLE 1557 >ref|XP_003517385.1| PREDICTED: regulator of nonsense transcripts 1 homolog [Glycine max] Length = 1266 Score = 71.6 bits (174), Expect = 5e-10 Identities = 26/33 (78%), Positives = 32/33 (96%) Frame = +3 Query: 1503 GSFMPPGPPNGTHKPGLHTAGYPMPRVPIPPYH 1601 GS++PPGPPNGTHKPG+H AGYP+PRVP+PP+H Sbjct: 973 GSYIPPGPPNGTHKPGVHPAGYPVPRVPLPPFH 1005 >ref|XP_003602889.1| Neurobeachin [Medicago truncatula] gi|355491937|gb|AES73140.1| Neurobeachin [Medicago truncatula] Length = 3300 Score = 70.9 bits (172), Expect = 9e-10 Identities = 34/47 (72%), Positives = 40/47 (85%) Frame = +1 Query: 433 RQSIALSDIKALITFFETSQDMVCIEDVLHMVICAISQKQLLAIYLK 573 RQ+IA D+KALI FFETSQDM CIEDVLHM+I A+SQK LLA +L+ Sbjct: 1615 RQNIAAGDMKALIAFFETSQDMTCIEDVLHMIIRAVSQKSLLASFLE 1661