BLASTX nr result
ID: Panax21_contig00002099
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00002099 (1059 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525028.1| conserved hypothetical protein [Ricinus comm... 68 4e-09 ref|XP_002525029.1| conserved hypothetical protein [Ricinus comm... 67 6e-09 ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853... 61 5e-07 >ref|XP_002525028.1| conserved hypothetical protein [Ricinus communis] gi|223535690|gb|EEF37355.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 67.8 bits (164), Expect = 4e-09 Identities = 32/70 (45%), Positives = 42/70 (60%) Frame = -3 Query: 838 MMQKKTLAIALVWLLVASSIMMCVFAAADTTPLKTADQVLHPLAGCRCCNYIKVREFFNC 659 M++K+ L IAL W LV SI +C A A L+T++ ++ P AGCRCC +I C Sbjct: 1 MVRKEKLFIALTWFLVVMSIAICANATAGPR-LQTSEHMVQPQAGCRCCFFIGRIPNIRC 59 Query: 658 NKVCCVDGCC 629 VCC DGCC Sbjct: 60 GNVCCEDGCC 69 >ref|XP_002525029.1| conserved hypothetical protein [Ricinus communis] gi|223535691|gb|EEF37356.1| conserved hypothetical protein [Ricinus communis] Length = 70 Score = 67.4 bits (163), Expect = 6e-09 Identities = 31/71 (43%), Positives = 42/71 (59%) Frame = -3 Query: 838 MMQKKTLAIALVWLLVASSIMMCVFAAADTTPLKTADQVLHPLAGCRCCNYIKVREFFNC 659 M++K+ L IAL W LV S+ +C A A L+ +D+ + AGCRCC +I + C Sbjct: 1 MVRKEKLFIALTWFLVVMSVAICANATAGPR-LQASDEHMELPAGCRCCYFIGQIPYMRC 59 Query: 658 NKVCCVDGCCG 626 VCC DGCCG Sbjct: 60 GMVCCQDGCCG 70 >ref|XP_003635480.1| PREDICTED: uncharacterized protein LOC100853147 [Vitis vinifera] gi|296090665|emb|CBI41065.3| unnamed protein product [Vitis vinifera] Length = 68 Score = 60.8 bits (146), Expect = 5e-07 Identities = 30/72 (41%), Positives = 41/72 (56%) Frame = -3 Query: 835 MQKKTLAIALVWLLVASSIMMCVFAAADTTPLKTADQVLHPLAGCRCCNYIKVREFFNCN 656 M+K+ L AL WLLV + + V A T + + ++HP AGCRCC +I + +C Sbjct: 1 MRKEILVTALAWLLVVAFV---VTYATATDHFQAVEDMVHPQAGCRCCWFI-WKPRISCG 56 Query: 655 KVCCVDGCCGRK 620 K CC DGCC K Sbjct: 57 KACCGDGCCSLK 68