BLASTX nr result
ID: Panax21_contig00001979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00001979 (1024 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277930.1| PREDICTED: putative DNA-binding protein ESCA... 39 5e-06 >ref|XP_002277930.1| PREDICTED: putative DNA-binding protein ESCAROLA-like [Vitis vinifera] Length = 327 Score = 39.3 bits (90), Expect(2) = 5e-06 Identities = 31/70 (44%), Positives = 36/70 (51%), Gaps = 14/70 (20%) Frame = -1 Query: 505 EQEFMEN------TTTN-------SSRSKPNTNSANQN-REEDGNGQDNEQQELAENHNA 368 EQEFM+N TTTN SS + PN ++ANQN EED D E E NA Sbjct: 42 EQEFMDNNNNNTTTTTNTTATNSSSSNTNPNPSAANQNPEEEDSREIDLEDSE----QNA 97 Query: 367 GALEISESFS 338 G EI+E S Sbjct: 98 GGHEIAEPSS 107 Score = 38.1 bits (87), Expect(2) = 5e-06 Identities = 19/33 (57%), Positives = 27/33 (81%), Gaps = 1/33 (3%) Frame = -2 Query: 606 WAGNVAM-NPMSSPSSIHMRNSGGDEDKTGLDR 511 WAGNVAM +PMSS S+H+RN+ ++D+ GL+R Sbjct: 6 WAGNVAMRDPMSSAPSLHLRNT--EDDQGGLNR 36