BLASTX nr result
ID: Panax21_contig00001713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00001713 (550 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABF70012.1| hypothetical protein MA4_8L21.30 [Musa acuminata] 70 3e-10 ref|XP_004168196.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 69 4e-10 ref|XP_004141987.1| PREDICTED: uncharacterized protein LOC101213... 69 4e-10 ref|XP_002525267.1| conserved hypothetical protein [Ricinus comm... 67 2e-09 ref|XP_002277749.2| PREDICTED: uncharacterized protein LOC100264... 67 2e-09 >gb|ABF70012.1| hypothetical protein MA4_8L21.30 [Musa acuminata] Length = 1015 Score = 69.7 bits (169), Expect = 3e-10 Identities = 34/56 (60%), Positives = 42/56 (75%) Frame = +3 Query: 381 GRMSMLEAYAEIVFSAWKIGNRGLREEIENGFLQALVESAIHAISVPFATSIRKVL 548 GR S+LEAYA+I+F +WK LREEIE+GFLQ L+E AIHA S A S+R+VL Sbjct: 23 GRKSVLEAYADILFRSWKGSEESLREEIEDGFLQGLIEGAIHASSKLLAASVRRVL 78 >ref|XP_004168196.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101225636 [Cucumis sativus] Length = 1217 Score = 69.3 bits (168), Expect = 4e-10 Identities = 34/56 (60%), Positives = 39/56 (69%) Frame = +3 Query: 381 GRMSMLEAYAEIVFSAWKIGNRGLREEIENGFLQALVESAIHAISVPFATSIRKVL 548 GR SMLEAY +IVF AW+ R+EIENGFLQ LVE IHA + F SIR+VL Sbjct: 285 GRKSMLEAYGDIVFRAWRNSEENTRDEIENGFLQGLVEGVIHARTSAFGASIRRVL 340 >ref|XP_004141987.1| PREDICTED: uncharacterized protein LOC101213278 [Cucumis sativus] Length = 1217 Score = 69.3 bits (168), Expect = 4e-10 Identities = 34/56 (60%), Positives = 39/56 (69%) Frame = +3 Query: 381 GRMSMLEAYAEIVFSAWKIGNRGLREEIENGFLQALVESAIHAISVPFATSIRKVL 548 GR SMLEAY +IVF AW+ R+EIENGFLQ LVE IHA + F SIR+VL Sbjct: 285 GRKSMLEAYGDIVFRAWRNSEENTRDEIENGFLQGLVEGVIHARTSAFGASIRRVL 340 >ref|XP_002525267.1| conserved hypothetical protein [Ricinus communis] gi|223535425|gb|EEF37095.1| conserved hypothetical protein [Ricinus communis] Length = 1216 Score = 67.0 bits (162), Expect = 2e-09 Identities = 33/56 (58%), Positives = 44/56 (78%) Frame = +3 Query: 381 GRMSMLEAYAEIVFSAWKIGNRGLREEIENGFLQALVESAIHAISVPFATSIRKVL 548 GR S+LEAY EI+F AWK N L++EIENGFLQ L+E+AI++ S A+S+R+VL Sbjct: 273 GRKSILEAYGEILFRAWKGVNGELKDEIENGFLQGLIEAAIYSSSGVLASSVRRVL 328 >ref|XP_002277749.2| PREDICTED: uncharacterized protein LOC100264215 [Vitis vinifera] Length = 1295 Score = 66.6 bits (161), Expect = 2e-09 Identities = 35/56 (62%), Positives = 38/56 (67%) Frame = +3 Query: 381 GRMSMLEAYAEIVFSAWKIGNRGLREEIENGFLQALVESAIHAISVPFATSIRKVL 548 GR SMLE Y +IVF AWK R EIENGFLQ L+E AIHA S A SIR+VL Sbjct: 265 GRKSMLETYGDIVFQAWKHVEGESRNEIENGFLQGLIEGAIHANSGALAASIRRVL 320