BLASTX nr result
ID: Panax21_contig00001562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00001562 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136262.1| PREDICTED: WD and tetratricopeptide repeats ... 56 4e-06 >ref|XP_004136262.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus] gi|449497029|ref|XP_004160293.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Cucumis sativus] Length = 759 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -2 Query: 135 IMQLGKHKEALDFAIAAQSLAPSDCEISGTVECIREELAAANSDK 1 + QLG+HKEALDFA AAQ LAPS+ E++ VE I+ +LAAA +K Sbjct: 450 LSQLGRHKEALDFAFAAQCLAPSNSEVAEKVESIKRDLAAAELEK 494