BLASTX nr result
ID: Panax21_contig00001499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00001499 (1183 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523498.1| ATP binding protein, putative [Ricinus commu... 44 6e-06 >ref|XP_002523498.1| ATP binding protein, putative [Ricinus communis] gi|223537205|gb|EEF38837.1| ATP binding protein, putative [Ricinus communis] Length = 1365 Score = 43.5 bits (101), Expect(3) = 6e-06 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 7/36 (19%) Frame = +1 Query: 520 SSRKHKPFNSS-------RRGRSELERWTSHKERDF 606 SS++HK SS RRGRS+LERWTSHKERD+ Sbjct: 1200 SSKRHKEDASSDEEQQDSRRGRSKLERWTSHKERDY 1235 Score = 28.1 bits (61), Expect(3) = 6e-06 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 14/60 (23%) Frame = +1 Query: 784 DVEVKPMEDRHLDAS*LLQS*RNK--------------KKVENEPSPPLQIETCTDIETK 921 D + KP+ED HLD L+ + KK+E+E P ++ +T D+E K Sbjct: 1293 DNDTKPLEDWHLDTVEKLKKRSERFKLPMPSEKDALVVKKMESEALPSVKTDTPVDLEIK 1352 Score = 24.6 bits (52), Expect(3) = 6e-06 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +2 Query: 614 ALNHLVPASLNVKEIDGHKKSGTSLANK 697 ++N ASL KEID + SG ANK Sbjct: 1236 SINSKSSASLKFKEIDRNNNSGPLEANK 1263