BLASTX nr result
ID: Panax21_contig00001460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00001460 (395 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137388.1| PREDICTED: WW domain-containing oxidoreducta... 55 4e-06 >ref|XP_004137388.1| PREDICTED: WW domain-containing oxidoreductase-like [Cucumis sativus] gi|449507149|ref|XP_004162946.1| PREDICTED: WW domain-containing oxidoreductase-like [Cucumis sativus] Length = 390 Score = 55.5 bits (132), Expect = 4e-06 Identities = 37/74 (50%), Positives = 42/74 (56%), Gaps = 4/74 (5%) Frame = -3 Query: 222 HYRKSNHLQNRFVKDRNRWKE--RGWY--CEEVLFQRIEASHXXXXXXXXXXNDITCIIT 55 H +K N+ NR K W E RGW E+LFQRI ASH ND+TCI+T Sbjct: 18 HRKKKNNNNNR-KKGALGWVEWLRGWMYVIHEMLFQRIMASHLQNPMPLPPVNDLTCIVT 76 Query: 54 ESTSGIDREIARLL 13 STSGI REIAR L Sbjct: 77 GSTSGIGREIARQL 90