BLASTX nr result
ID: Panax21_contig00001153
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00001153 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL64029.1| ribosomal protein S3 [Trimenia moorei] 69 5e-10 gb|ADL63889.1| ribosomal protein S3 [Impatiens pallida] 67 2e-09 gb|AEH27071.1| ribosomal protein S3 [Mimulus aurantiacus] 66 3e-09 gb|ADL64019.1| ribosomal protein S3 [Ternstroemia stahlii] 65 4e-09 gb|ADL63971.1| ribosomal protein S3 [Quillaja saponaria] 65 4e-09 >gb|ADL64029.1| ribosomal protein S3 [Trimenia moorei] Length = 500 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -2 Query: 389 PSFHYSVMQYLLNTKNKMHFDPVVVLKHFLAP 294 PSFHYSVMQYLLNTKNKMHFDPVVVL HF+AP Sbjct: 167 PSFHYSVMQYLLNTKNKMHFDPVVVLNHFVAP 198 >gb|ADL63889.1| ribosomal protein S3 [Impatiens pallida] Length = 473 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 389 PSFHYSVMQYLLNTKNKMHFDPVVVLKHFLAPQSTKTS 276 PSFHYSVMQYLLNTKN+MHFDPV VL HF+AP T+ S Sbjct: 164 PSFHYSVMQYLLNTKNQMHFDPVSVLNHFVAPGVTEPS 201 >gb|AEH27071.1| ribosomal protein S3 [Mimulus aurantiacus] Length = 497 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 386 SFHYSVMQYLLNTKNKMHFDPVVVLKHFLAP 294 SFHYSVMQYLLNTKNKMHFDPVVVL HF+AP Sbjct: 182 SFHYSVMQYLLNTKNKMHFDPVVVLNHFVAP 212 >gb|ADL64019.1| ribosomal protein S3 [Ternstroemia stahlii] Length = 483 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 389 PSFHYSVMQYLLNTKNKMHFDPVVVLKHFLAPQSTKTS 276 PS +YSVMQYLLNTKNKMHFDPVVVL HF+AP T+ S Sbjct: 164 PSLNYSVMQYLLNTKNKMHFDPVVVLNHFVAPGVTEPS 201 >gb|ADL63971.1| ribosomal protein S3 [Quillaja saponaria] Length = 449 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 389 PSFHYSVMQYLLNTKNKMHFDPVVVLKHFLAP 294 PSFH+SVMQYLLNTKNK+HFDPVVVL HF+AP Sbjct: 135 PSFHFSVMQYLLNTKNKIHFDPVVVLNHFVAP 166