BLASTX nr result
ID: Panax21_contig00001113
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00001113 (356 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA75116.1| DAL1 protein [Arabidopsis thaliana] gi|2440031|e... 95 5e-18 ref|XP_002879451.1| hypothetical protein ARALYDRAFT_482286 [Arab... 95 5e-18 ref|NP_180901.1| protein differentiation and greening-like 1 [Ar... 95 5e-18 emb|CAB06698.1| plastid protein [Arabidopsis thaliana] 95 5e-18 ref|XP_003570764.1| PREDICTED: DAG protein, chloroplastic-like [... 95 7e-18 >emb|CAA75116.1| DAL1 protein [Arabidopsis thaliana] gi|2440031|emb|CAA75115.1| DAL1 protein [Arabidopsis thaliana] Length = 219 Score = 95.1 bits (235), Expect = 5e-18 Identities = 48/64 (75%), Positives = 53/64 (82%), Gaps = 2/64 (3%) Frame = +3 Query: 3 LFVLPYFYVDAENKDYGAELLVNGEIVKRSPERERRVQPVPQRAQDRPR*ND--GYNNRR 176 LFVLP YVD ENKDYGAEL VNGEIV+RSPER+RRV+P PQRAQDRPR ND Y+ RR Sbjct: 156 LFVLPDSYVDPENKDYGAELFVNGEIVQRSPERQRRVEPQPQRAQDRPRYNDRTRYSRRR 215 Query: 177 QNMR 188 +N R Sbjct: 216 ENTR 219 >ref|XP_002879451.1| hypothetical protein ARALYDRAFT_482286 [Arabidopsis lyrata subsp. lyrata] gi|297325290|gb|EFH55710.1| hypothetical protein ARALYDRAFT_482286 [Arabidopsis lyrata subsp. lyrata] Length = 219 Score = 95.1 bits (235), Expect = 5e-18 Identities = 48/64 (75%), Positives = 53/64 (82%), Gaps = 2/64 (3%) Frame = +3 Query: 3 LFVLPYFYVDAENKDYGAELLVNGEIVKRSPERERRVQPVPQRAQDRPR*ND--GYNNRR 176 LFVLP YVD ENKDYGAEL VNGEIV+RSPER+RRV+P PQRAQDRPR ND Y+ RR Sbjct: 156 LFVLPDSYVDPENKDYGAELFVNGEIVQRSPERQRRVEPQPQRAQDRPRYNDRTRYSRRR 215 Query: 177 QNMR 188 +N R Sbjct: 216 ENTR 219 >ref|NP_180901.1| protein differentiation and greening-like 1 [Arabidopsis thaliana] gi|17933285|gb|AAL48226.1|AF446351_1 At2g33430/F4P9.20 [Arabidopsis thaliana] gi|2459425|gb|AAB80660.1| plastid protein [Arabidopsis thaliana] gi|20453405|gb|AAM19941.1| At2g33430/F4P9.20 [Arabidopsis thaliana] gi|110736869|dbj|BAF00392.1| plastid protein [Arabidopsis thaliana] gi|330253739|gb|AEC08833.1| protein differentiation and greening-like 1 [Arabidopsis thaliana] Length = 219 Score = 95.1 bits (235), Expect = 5e-18 Identities = 48/64 (75%), Positives = 53/64 (82%), Gaps = 2/64 (3%) Frame = +3 Query: 3 LFVLPYFYVDAENKDYGAELLVNGEIVKRSPERERRVQPVPQRAQDRPR*ND--GYNNRR 176 LFVLP YVD ENKDYGAEL VNGEIV+RSPER+RRV+P PQRAQDRPR ND Y+ RR Sbjct: 156 LFVLPDSYVDPENKDYGAELFVNGEIVQRSPERQRRVEPQPQRAQDRPRYNDRTRYSRRR 215 Query: 177 QNMR 188 +N R Sbjct: 216 ENTR 219 >emb|CAB06698.1| plastid protein [Arabidopsis thaliana] Length = 198 Score = 95.1 bits (235), Expect = 5e-18 Identities = 48/64 (75%), Positives = 53/64 (82%), Gaps = 2/64 (3%) Frame = +3 Query: 3 LFVLPYFYVDAENKDYGAELLVNGEIVKRSPERERRVQPVPQRAQDRPR*ND--GYNNRR 176 LFVLP YVD ENKDYGAEL VNGEIV+RSPER+RRV+P PQRAQDRPR ND Y+ RR Sbjct: 135 LFVLPDSYVDPENKDYGAELFVNGEIVQRSPERQRRVEPQPQRAQDRPRYNDRTRYSRRR 194 Query: 177 QNMR 188 +N R Sbjct: 195 ENTR 198 >ref|XP_003570764.1| PREDICTED: DAG protein, chloroplastic-like [Brachypodium distachyon] Length = 239 Score = 94.7 bits (234), Expect = 7e-18 Identities = 48/64 (75%), Positives = 52/64 (81%), Gaps = 2/64 (3%) Frame = +3 Query: 3 LFVLPYFYVDAENKDYGAELLVNGEIVKRSPERERRVQPVPQRAQDRPR*ND--GYNNRR 176 LFVLP YVD ENKDYGAEL VNGEIV+RSPER+RRV+PVPQRA DRPR ND Y RR Sbjct: 176 LFVLPDSYVDPENKDYGAELFVNGEIVQRSPERQRRVEPVPQRASDRPRYNDRTRYARRR 235 Query: 177 QNMR 188 +N R Sbjct: 236 ENQR 239