BLASTX nr result
ID: Panax21_contig00000442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000442 (1102 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003540213.1| PREDICTED: bifunctional polymyxin resistance... 79 3e-12 gb|AEP17007.1| UDP-D-apiose/UPD-D-xylose synthetase [Vitis vinif... 79 3e-12 gb|ACJ11753.1| UDP-D-apiose/UPD-D-xylose synthetase [Gossypium h... 79 3e-12 gb|ACF74277.1| putative dihydroflavonol reductase [Arachis hypog... 79 3e-12 ref|XP_002266630.1| PREDICTED: bifunctional polymyxin resistance... 79 3e-12 >ref|XP_003540213.1| PREDICTED: bifunctional polymyxin resistance protein ArnA-like [Glycine max] Length = 387 Score = 78.6 bits (192), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 264 VKYCSENNKRLIHFSTCEVYGKTIGSYLPKDSPLRQ 371 VKYCSENNKRLIHFSTCEVYGKTIGS+LPKDSPLRQ Sbjct: 122 VKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQ 157 >gb|AEP17007.1| UDP-D-apiose/UPD-D-xylose synthetase [Vitis vinifera] Length = 388 Score = 78.6 bits (192), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 264 VKYCSENNKRLIHFSTCEVYGKTIGSYLPKDSPLRQ 371 VKYCSENNKRLIHFSTCEVYGKTIGS+LPKDSPLRQ Sbjct: 123 VKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQ 158 >gb|ACJ11753.1| UDP-D-apiose/UPD-D-xylose synthetase [Gossypium hirsutum] Length = 386 Score = 78.6 bits (192), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 264 VKYCSENNKRLIHFSTCEVYGKTIGSYLPKDSPLRQ 371 VKYCSENNKRLIHFSTCEVYGKTIGS+LPKDSPLRQ Sbjct: 121 VKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQ 156 >gb|ACF74277.1| putative dihydroflavonol reductase [Arachis hypogaea] Length = 217 Score = 78.6 bits (192), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 264 VKYCSENNKRLIHFSTCEVYGKTIGSYLPKDSPLRQ 371 VKYCSENNKRLIHFSTCEVYGKTIGS+LPKDSPLRQ Sbjct: 129 VKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQ 164 >ref|XP_002266630.1| PREDICTED: bifunctional polymyxin resistance protein ArnA [Vitis vinifera] gi|296087442|emb|CBI34031.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 78.6 bits (192), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 264 VKYCSENNKRLIHFSTCEVYGKTIGSYLPKDSPLRQ 371 VKYCSENNKRLIHFSTCEVYGKTIGS+LPKDSPLRQ Sbjct: 123 VKYCSENNKRLIHFSTCEVYGKTIGSFLPKDSPLRQ 158