BLASTX nr result
ID: Panax21_contig00000405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000405 (385 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134114.1| PREDICTED: protein argonaute 10-like [Cucumi... 79 3e-13 ref|XP_003519706.1| PREDICTED: protein argonaute 10-like [Glycin... 76 2e-12 ref|XP_002517060.1| eukaryotic translation initiation factor 2c,... 75 6e-12 ref|XP_002314663.1| argonaute protein group [Populus trichocarpa... 75 6e-12 ref|NP_199194.1| protein PINHEAD [Arabidopsis thaliana] gi|33418... 75 7e-12 >ref|XP_004134114.1| PREDICTED: protein argonaute 10-like [Cucumis sativus] gi|449523115|ref|XP_004168570.1| PREDICTED: protein argonaute 10-like [Cucumis sativus] Length = 984 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 122 IEVCKIVGDQRYTKRLNDKQITALLKVTCQRPRDRENDILQ 244 +E CKIVG QRYTKRLN+KQITALLKVTCQRPRDRENDILQ Sbjct: 441 MEACKIVGGQRYTKRLNEKQITALLKVTCQRPRDRENDILQ 481 >ref|XP_003519706.1| PREDICTED: protein argonaute 10-like [Glycine max] Length = 972 Score = 76.3 bits (186), Expect = 2e-12 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +2 Query: 122 IEVCKIVGDQRYTKRLNDKQITALLKVTCQRPRDRENDILQ 244 +E CKIV QRYTKRLN+KQITALLKVTCQRPRDRENDILQ Sbjct: 427 MEACKIVEGQRYTKRLNEKQITALLKVTCQRPRDRENDILQ 467 >ref|XP_002517060.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] gi|223543695|gb|EEF45223.1| eukaryotic translation initiation factor 2c, putative [Ricinus communis] Length = 986 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 122 IEVCKIVGDQRYTKRLNDKQITALLKVTCQRPRDRENDILQ 244 +E CKIV QRYTKRLN++QITALLKVTCQRPRDRENDILQ Sbjct: 445 MEACKIVEGQRYTKRLNERQITALLKVTCQRPRDRENDILQ 485 >ref|XP_002314663.1| argonaute protein group [Populus trichocarpa] gi|222863703|gb|EEF00834.1| argonaute protein group [Populus trichocarpa] Length = 820 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 122 IEVCKIVGDQRYTKRLNDKQITALLKVTCQRPRDRENDILQ 244 +E CKIV QRYTKRLN++QITALLKVTCQRPRDRENDILQ Sbjct: 271 MEACKIVEGQRYTKRLNERQITALLKVTCQRPRDRENDILQ 311 >ref|NP_199194.1| protein PINHEAD [Arabidopsis thaliana] gi|334188178|ref|NP_001190464.1| protein PINHEAD [Arabidopsis thaliana] gi|12643935|sp|Q9XGW1.1|AGO10_ARATH RecName: Full=Protein argonaute 10; AltName: Full=Protein PINHEAD; AltName: Full=Protein ZWILLE gi|5107374|gb|AAD40098.1|AF154272_1 PINHEAD [Arabidopsis thaliana] gi|10177951|dbj|BAB11310.1| PINHEAD [Arabidopsis thaliana] gi|332007628|gb|AED95011.1| protein PINHEAD [Arabidopsis thaliana] gi|332007629|gb|AED95012.1| protein PINHEAD [Arabidopsis thaliana] Length = 988 Score = 74.7 bits (182), Expect = 7e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 122 IEVCKIVGDQRYTKRLNDKQITALLKVTCQRPRDRENDILQ 244 +E CKIV QRYTKRLN+KQITALLKVTCQRPRDRENDIL+ Sbjct: 444 MEACKIVEGQRYTKRLNEKQITALLKVTCQRPRDRENDILR 484