BLASTX nr result
ID: Panax21_contig00000373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000373 (2516 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAD30220.1|AC007202_2 Is a member of PF|00004 ATPases associa... 59 6e-06 ref|NP_565212.1| cell division protease ftsH-12 [Arabidopsis tha... 59 6e-06 >gb|AAD30220.1|AC007202_2 Is a member of PF|00004 ATPases associated with various cellular activities (AAA) family. ESTs gb|T43031, gb|R64750, gb|AA394742 and gb|AI100347 come from this gene [Arabidopsis thaliana] Length = 998 Score = 58.9 bits (141), Expect = 6e-06 Identities = 26/53 (49%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = -2 Query: 1639 NGTLTHDSFYVGKNAWDDEVETSHDDVKDTVNQDGRLNIVEKKPI-QDLGISG 1484 +GTL HDS YVG+NAWDD++ET+ +K + ++ R+ KK + QDLG+SG Sbjct: 229 DGTLVHDSSYVGENAWDDDLETTEGSLKKIIGRNARIQTEAKKKLSQDLGVSG 281 >ref|NP_565212.1| cell division protease ftsH-12 [Arabidopsis thaliana] gi|190359474|sp|Q9SAJ3.2|FTSHC_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 12, chloroplastic; Short=AtFTSH12; Flags: Precursor gi|222424637|dbj|BAH20273.1| AT1G79560 [Arabidopsis thaliana] gi|332198143|gb|AEE36264.1| cell division protease ftsH-12 [Arabidopsis thaliana] Length = 1008 Score = 58.9 bits (141), Expect = 6e-06 Identities = 26/53 (49%), Positives = 38/53 (71%), Gaps = 1/53 (1%) Frame = -2 Query: 1639 NGTLTHDSFYVGKNAWDDEVETSHDDVKDTVNQDGRLNIVEKKPI-QDLGISG 1484 +GTL HDS YVG+NAWDD++ET+ +K + ++ R+ KK + QDLG+SG Sbjct: 229 DGTLVHDSSYVGENAWDDDLETTEGSLKKIIGRNARIQTEAKKKLSQDLGVSG 281