BLASTX nr result
ID: Panax21_contig00000279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000279 (1501 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_568608.2| metalloendopeptidase [Arabidopsis thaliana] gi|... 68 5e-09 ref|NP_001190451.1| metalloendopeptidase / zinc ion binding prot... 68 5e-09 ref|XP_002865503.1| metalloendopeptidase/ metallopeptidase/ zinc... 68 5e-09 dbj|BAB10500.1| major surface glycoprotein-like [Arabidopsis tha... 68 5e-09 ref|XP_002510341.1| metalloendopeptidase, putative [Ricinus comm... 68 7e-09 >ref|NP_568608.2| metalloendopeptidase [Arabidopsis thaliana] gi|51970518|dbj|BAD43951.1| major surface like glycoprotein [Arabidopsis thaliana] gi|62319804|dbj|BAD93815.1| major surface like glycoprotein [Arabidopsis thaliana] gi|110740450|dbj|BAF02119.1| major surface like glycoprotein [Arabidopsis thaliana] gi|332007453|gb|AED94836.1| metalloendopeptidase [Arabidopsis thaliana] Length = 841 Score = 68.2 bits (165), Expect = 5e-09 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 200 RRALAVERVRGNLQLSGYSACGQDGGVQLPWEYV-EGIAD 84 RRALAVE V+GNL+LSGYSACGQDGGVQLP EYV EGIAD Sbjct: 197 RRALAVEPVKGNLRLSGYSACGQDGGVQLPREYVEEGIAD 236 >ref|NP_001190451.1| metalloendopeptidase / zinc ion binding protein [Arabidopsis thaliana] gi|332007454|gb|AED94837.1| metalloendopeptidase / zinc ion binding protein [Arabidopsis thaliana] Length = 889 Score = 68.2 bits (165), Expect = 5e-09 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 200 RRALAVERVRGNLQLSGYSACGQDGGVQLPWEYV-EGIAD 84 RRALAVE V+GNL+LSGYSACGQDGGVQLP EYV EGIAD Sbjct: 197 RRALAVEPVKGNLRLSGYSACGQDGGVQLPREYVEEGIAD 236 >ref|XP_002865503.1| metalloendopeptidase/ metallopeptidase/ zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] gi|297311338|gb|EFH41762.1| metalloendopeptidase/ metallopeptidase/ zinc ion binding protein [Arabidopsis lyrata subsp. lyrata] Length = 848 Score = 68.2 bits (165), Expect = 5e-09 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 200 RRALAVERVRGNLQLSGYSACGQDGGVQLPWEYV-EGIAD 84 RRALAVE V+GNL+LSGYSACGQDGGVQLP EYV EGIAD Sbjct: 204 RRALAVEPVKGNLRLSGYSACGQDGGVQLPREYVEEGIAD 243 >dbj|BAB10500.1| major surface glycoprotein-like [Arabidopsis thaliana] Length = 545 Score = 68.2 bits (165), Expect = 5e-09 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 200 RRALAVERVRGNLQLSGYSACGQDGGVQLPWEYV-EGIAD 84 RRALAVE V+GNL+LSGYSACGQDGGVQLP EYV EGIAD Sbjct: 197 RRALAVEPVKGNLRLSGYSACGQDGGVQLPREYVEEGIAD 236 >ref|XP_002510341.1| metalloendopeptidase, putative [Ricinus communis] gi|223551042|gb|EEF52528.1| metalloendopeptidase, putative [Ricinus communis] Length = 844 Score = 67.8 bits (164), Expect = 7e-09 Identities = 33/40 (82%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 200 RRALAVERVRGNLQLSGYSACGQDGGVQLPWEYVE-GIAD 84 RRALAVE V+GNL+LSGYSACGQDGGVQLP EY+E G+AD Sbjct: 186 RRALAVEPVKGNLRLSGYSACGQDGGVQLPHEYIEVGVAD 225