BLASTX nr result
ID: Panax21_contig00000242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000242 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] g... 60 1e-07 >ref|NP_001234382.1| nuclear GTPase-like [Solanum lycopersicum] gi|83630757|gb|ABC26876.1| putative nuclear GTPase [Solanum lycopersicum] Length = 609 Score = 60.5 bits (145), Expect = 1e-07 Identities = 33/61 (54%), Positives = 39/61 (63%) Frame = -1 Query: 359 KLRKAEKRRKKTIKSSAMGDDMEGDYDFKVDYVKGDSDMDDAGDHEAALASIPSKNRFEM 180 K +KAEK+R+K K S DM+GDYDFKVDY+K DS MDDA E NRFE+ Sbjct: 544 KQKKAEKKRRKKDKPST-AIDMDGDYDFKVDYIKKDSAMDDA--DEVVATDESKNNRFEL 600 Query: 179 P 177 P Sbjct: 601 P 601