BLASTX nr result
ID: Panax21_contig00000174
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax21_contig00000174 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514271.1| F-box and wd40 domain protein, putative [Ric... 107 1e-21 emb|CBI28040.3| unnamed protein product [Vitis vinifera] 105 4e-21 emb|CAN83797.1| hypothetical protein VITISV_002973 [Vitis vinifera] 105 4e-21 ref|XP_003630767.1| U-box domain-containing protein [Medicago tr... 102 3e-20 ref|XP_003524399.1| PREDICTED: uncharacterized protein LOC100787... 100 1e-19 >ref|XP_002514271.1| F-box and wd40 domain protein, putative [Ricinus communis] gi|223546727|gb|EEF48225.1| F-box and wd40 domain protein, putative [Ricinus communis] Length = 1268 Score = 107 bits (266), Expect = 1e-21 Identities = 59/96 (61%), Positives = 69/96 (71%), Gaps = 2/96 (2%) Frame = -1 Query: 445 QKLNGTQLPKTNYVLKRLIASWREHNPNLDLIQSENQYQESEPNFSSGM--PLASPDSVI 272 Q L+ QLPKTNYVLKRL+ASWRE NP QSE Q++EPNF S + P+ SP+SVI Sbjct: 460 QALHSNQLPKTNYVLKRLVASWREQNPEFASNQSETAPQKTEPNFKSTIISPVTSPNSVI 519 Query: 271 WQVTMDCTVGEL*LAIKNLCMSEILKESEMAVLWIE 164 Q +D T+ EL AI +LCMSEIL ESEMAVL IE Sbjct: 520 SQSAIDSTMSELRQAITDLCMSEILSESEMAVLRIE 555 >emb|CBI28040.3| unnamed protein product [Vitis vinifera] Length = 1154 Score = 105 bits (262), Expect = 4e-21 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 4/98 (4%) Frame = -1 Query: 445 QKLNGTQLPKTNYVLKRLIASWREHNPNLDLIQSENQYQESEPNFSSGMPL---ASPDSV 275 QKL+ TQLPKTNYVLKRLIASW+E NP I S+N E++P F+S +P+ SP+SV Sbjct: 256 QKLHSTQLPKTNYVLKRLIASWQEQNPGFISIHSDNPDPETDPIFNSTLPVLPSTSPNSV 315 Query: 274 -IWQVTMDCTVGEL*LAIKNLCMSEILKESEMAVLWIE 164 I Q TMD T+ EL LAI LCMSEIL+ESE AVL IE Sbjct: 316 IISQATMDGTICELRLAITKLCMSEILRESEKAVLRIE 353 >emb|CAN83797.1| hypothetical protein VITISV_002973 [Vitis vinifera] Length = 1618 Score = 105 bits (262), Expect = 4e-21 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 4/98 (4%) Frame = -1 Query: 445 QKLNGTQLPKTNYVLKRLIASWREHNPNLDLIQSENQYQESEPNFSSGMPL---ASPDSV 275 QKL+ TQLPKTNYVLKRLIASW+E NP I S+N E++P F+S +P+ SP+SV Sbjct: 720 QKLHSTQLPKTNYVLKRLIASWQEQNPGFISIHSDNPDPETDPIFNSTLPVLPSTSPNSV 779 Query: 274 -IWQVTMDCTVGEL*LAIKNLCMSEILKESEMAVLWIE 164 I Q TMD T+ EL LAI LCMSEIL+ESE AVL IE Sbjct: 780 IISQATMDGTICELRLAITKLCMSEILRESEKAVLRIE 817 >ref|XP_003630767.1| U-box domain-containing protein [Medicago truncatula] gi|355524789|gb|AET05243.1| U-box domain-containing protein [Medicago truncatula] Length = 1068 Score = 102 bits (255), Expect = 3e-20 Identities = 55/94 (58%), Positives = 67/94 (71%) Frame = -1 Query: 445 QKLNGTQLPKTNYVLKRLIASWREHNPNLDLIQSENQYQESEPNFSSGMPLASPDSVIWQ 266 QKL T+LPKTNYVLKRL+ASW+EHNP+ E Y++SE + +P SP+SVI Q Sbjct: 196 QKLQNTKLPKTNYVLKRLVASWKEHNPSSVPPTCECPYKDSESVVKTEIPSTSPNSVITQ 255 Query: 265 VTMDCTVGEL*LAIKNLCMSEILKESEMAVLWIE 164 T+D +GEL AI NL MSEIL+ESEMA L IE Sbjct: 256 ATVDGMIGELRCAINNLYMSEILQESEMAALQIE 289 >ref|XP_003524399.1| PREDICTED: uncharacterized protein LOC100787950 [Glycine max] Length = 1421 Score = 100 bits (249), Expect = 1e-19 Identities = 55/94 (58%), Positives = 66/94 (70%) Frame = -1 Query: 445 QKLNGTQLPKTNYVLKRLIASWREHNPNLDLIQSENQYQESEPNFSSGMPLASPDSVIWQ 266 QKL TQLPKTNYVLKRLIASW++ NP+L E Y+E+E +P SP+SVI Q Sbjct: 498 QKLQNTQLPKTNYVLKRLIASWKDRNPHLVPPSYEIPYEETEEAVKLTIPSTSPNSVITQ 557 Query: 265 VTMDCTVGEL*LAIKNLCMSEILKESEMAVLWIE 164 T+D + EL AI NL MSE+L+ESEMAVL IE Sbjct: 558 ATVDGMMSELRCAINNLYMSEVLQESEMAVLQIE 591