BLASTX nr result
ID: Paeonia25_contig00054799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054799 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598423.1| hypothetical protein MTR_3g013490 [Medicago ... 56 6e-06 >ref|XP_003598423.1| hypothetical protein MTR_3g013490 [Medicago truncatula] gi|355487471|gb|AES68674.1| hypothetical protein MTR_3g013490 [Medicago truncatula] Length = 1201 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/66 (48%), Positives = 36/66 (54%), Gaps = 7/66 (10%) Frame = -1 Query: 309 FNELFKEPQTPSEQALKGSISEIKYANP-------SREEGRYNSCHLFLSGEDNSPVSFA 151 FNE K+ Q PS QA K KY SREEG Y SCHLFLSG D+S +S A Sbjct: 30 FNEYVKDSQAPSNQAEKDLAPSPKYGIDVKDVDVLSREEGGYRSCHLFLSGSDSSSLSVA 89 Query: 150 SPSGNM 133 GN+ Sbjct: 90 PSPGNV 95