BLASTX nr result
ID: Paeonia25_contig00054676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Paeonia25_contig00054676 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD35328.1| hypothetical protein CERSUDRAFT_139022 [Ceriporio... 81 1e-13 >gb|EMD35328.1| hypothetical protein CERSUDRAFT_139022 [Ceriporiopsis subvermispora B] Length = 2121 Score = 81.3 bits (199), Expect = 1e-13 Identities = 45/78 (57%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = +1 Query: 7 QTRQKFEREATQTTLGSSLHLPFLSSTTSLPMAASASTSTVHAPQKYGQLRRPPSISSLA 186 Q R KFEREA+Q T+GSSLHLPF+SS SLP+A+S + S V P + +RRP SI S+A Sbjct: 2 QLRPKFEREASQGTVGSSLHLPFMSSVASLPLASSTNVSAV--PTQKSGIRRPQSIQSMA 59 Query: 187 -AVGYTPSIAHITRALTA 237 TPS+ HITRALT+ Sbjct: 60 LGSRATPSVTHITRALTS 77